MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint verlhac-1997-1 Identification of partners of TIF34, a component of the yeast eIF3 complex, required for cell proliferation and translation initiation. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Verlhac MH., Chen RH., Hanachi P., Hershey JW., Derynck R. EMBO J. (0261-4189) 1997 verlhacm-1997-1 Identification of partners of TIF34, a component of the yeast eIF3 complex, required for cell proliferation and translation initiation. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Verlhac MH., Chen RH., Hanachi P., Hershey JW., Derynck R. EMBO J. (0261-4189) 1997 eif3g_yeast Eukaryotic translation initiation factor 3 subunit G TIF35 YDR429C D9461.16 Eukaryotic translation initiation factor 3 RNA-binding subunit Translation initiation factor eIF3 p33 subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEVAPEEIIENADGSRSIITYKIEDGVKYKITQKVKEVKVLEKVHKSVAERKNWHKYGSEKGSPAGPSAVTARLGEEVELRLSRNWKQAEEERIQKEKASLTKTGLQCRLCGNDHMTMNCPFKTILSELSALEDPATNEGGVEAASEEKAGQVGGAGSIPGQYVPPSRRAGARDPSSDAYRDSRERDDMCTLKIMQVNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNLILRVEWSKPKVKE 340A5285F2C84E06 eif3i_yeast Eukaryotic translation initiation factor 3 subunit I TIF34 YMR146C YM9375.16C Eukaryotic translation initiation factor 3 39 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MKAIKLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNGQCVATWKSPVPVKRVEFSPCGNYFLAILDNVMKNPGSINIYEIERDSATHELTKVSEEPIHKIITHEGLDAATVAGWSTKGKYIIAGHKDGKISKYDVSNNYEYVDSIDLHEKSISDMQFSPDLTYFITSSRDTNSFLVDVSTLQVLKKYETDCPLNTAVITPLKEFIILGGGQEAKDVTTTSANEGKFEARFYHKIFEEEIGRVQGHFGPLNTVAISPQGTSYASGGEDGFIRLHHFEKSYFDFKYDVEKAAEAKEHMQEAN E6C0D0B275E87622 eif3b_yeast Eukaryotic translation initiation factor 3 subunit B YOR361C PRT1 CDC63 Eukaryotic translation initiation factor 3 90 kDa subunit Translation initiation factor eIF3 p90 subunit Cell cycle regulation and translation initiation protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MKNFLPRTLKNIYELYFNNISVHSIVSRNTQLKRSKIIQMTTETFEDIKLEDIPVDDIDFSDLEEQYKVTEEFNFDQYIVVNGAPVIPSAKVPVLKKALTSLFSKAGKVVNMEFPIDEATGKTKGFLFVECGSMNDAKKIIKSFHGKRLDLKHRLFLYTMKDVERYNSDDFDTEFREPDMPTFVPSSSLKSWLMDDKVRDQFVLQDDVKTSVFWNSMFNEEDSLVESRENWSTNYVRFSPKGTYLFSYHQQGVTAWGGPNFDRLRRFYHPDVRNSSVSPNEKYLVTFSTEPIIVEEDNEFSPFTKKNEGHQLCIWDIASGLLMATFPVIKSPYLKWPLVRWSYNDKYCARMVGDSLIVHDATKNFMPLEAKALKPSGIRDFSFAPEGVKLQPFRNGDEPSVLLAYWTPETNNSACTATIAEVPRGRVLKTVNLVQVSNVTLHWQNQAEFLCFNVERHTKSGKTQFSNLQICRLTERDIPVEKVELKDSVFEFGWEPHGNRFVTISVHEVADMNYAIPANTIRFYAPETKEKTDVIKRWSLVKEIPKTFANTVSWSPAGRFVVVGALVGPNMRRSDLQFYDMDYPGEKNINDNNDVSASLKDVAHPTYSAATNITWDPSGRYVTAWSSSLKHKVEHGYKIFNIAGNLVKEDIIAGFKNFAWRPRPASILSNAERKKVRKNLREWSAQFEEQDAMEADTAMRDLILHQRELLKQWTEYREKIGQEMEKSMNFKIFDVQPEDASDDFTTIEEIVEEVLEETKEKVE F5E4E783408EE948 tif35-tif34-5 2797 eif3g_yeast 2799 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 eif3i_yeast 2800 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false TIF35 and TIF34 take part to the eIF3 complex in Saccharomyces cerevisiae homomint mint prt1-tif34-27 2797 eif3b_yeast 2801 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 eif3i_yeast 2800 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false PRT1 and TIF34 take part to the eIF3 complex in Saccharomyces cerevisiae homomint mint tif35-tif34-6 2798 eif3g_yeast 2799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 eif3i_yeast 2800 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false TIF35 and TIF34 take part to the eIF3 complex in Saccharomyces cerevisiae homomint mint