MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint waskiewi-1997-1 Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. EMBO J. (0261-4189) 1997 waskiewi-1997-3 Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. EMBO J. (0261-4189) 1997 waskiewi-1997-2 Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. EMBO J. (0261-4189) 1997 waskiewicz-1997-1 Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. in vitro In vitro experimental interac experimental interaction detection experimental interac predetermined predetermined participant predetermined Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. EMBO J. (0261-4189) 1997 waskiewi-1997-4 Mitogen-activated protein kinases activate the serine/threonine kinases Mnk1 and Mnk2. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Waskiewicz AJ., Flynn A., Proud CG., Cooper JA. EMBO J. (0261-4189) 1997 mk01_rat Mitogen-activated protein kinase 1 Mapk1 Erk2 Mapk Prkm1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 protein protein rat Rattus norvegicus (Rat) Rat MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS mknk2_mouse MAP kinase-interacting serine/threonine-protein kinase 2 MAP kinase signal-integrating kinase 2 Mknk2 Mnk2 protein protein mouse Mus musculus Mouse MVQKRTAELQGFHRSFKGQNPFELAFSLDLAQHRDSDFSPQCEARPDMPSSQPIDIPDAKKRGRKKKRCRATDSFSGRFEDVYQLQEDVLGEGAHARVQTCVNLITNQEYAVKIIEKQLGHIRSRVFREVEMLYQCQGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHRRRHFNELEASVVVQDVASALDFLHNKGIAHRDLKPENILCEHPNQVSPVKICDFDLGSGIKLNGDCSPISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWSLGVILYILLSGYPPFVGHCGSDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWSHISFAAKDLISKLLVRDAKQRLSAAQVLQHPWVQGCAPENTLPTPLVLQRNSCAKDLTSFAAEAIAMNRQLAQCEEDAGQDQPVVIRATSRCLQLSPPSQSKLAQRRQRASLSATPVVLVGDRA mknk1_mouse MAP kinase-interacting serine/threonine-protein kinase 1 MAP kinase signal-integrating kinase 1 Mknk1 Mnk1 protein protein mouse Mus musculus Mouse MVSSQKLEKPIEMGSSEPLPIVDSDKRRKKKRKTRATDSLPGKFEDVYQLTSELLGEGAYAKVQGAVNLQSGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNRNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKRKHFNEREASRVVRDVATALDFLHTKGIAHRDLKPENILCESPEKVSPVKICDFDLGSGVKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFRDEATFYDKRCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRMCQNKLFESIQEGKYEFPDKDWAHISNEAKDLISKLLVRDAKQRLSAAQVLQHPWVQGQAPERGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENELAEEQEALAEGLCSMKLSPPSKSRLARRRALAQAGRSRDANPCLTPAGL mk11_mouse Mitogen-activated protein kinase 11 Mitogen-activated protein kinase p38 beta Mapk11 Prkm11 protein protein mouse Mus musculus Mouse MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSVFHGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPDDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPLEPSQLPGTHEIEQ mk03_mouse Mitogen-activated protein kinase 3 Mapk3 Extracellular signal-regulated kinase 1 Insulin-stimulated MAP2 kinase p44-ERK1 ERT2 MAP kinase isoform p44 Microtubule-associated protein 2 kinase MNK1 Erk1 Prkm3 protein protein mouse Mus musculus Mouse MAAAAAAPGGGGGEPRGTAGVVPVVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGAPEGP mapk1-mknk2-23 2502 mk01_rat 2507 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 mknk2_mouse 2508 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint mapk1-mknk1-2 2502 mknk1_mouse 2509 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 mk01_rat 2507 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false mint mapk11-mknk1 2502 mknk1_mouse 2509 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 mk11_mouse 2510 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false NFA mint mapk1-mknk2-24 2503 mknk2_mouse 2508 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 mk01_rat 2507 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false homomint mint mapk1-mknk1-3 2503 mk01_rat 2507 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 mknk1_mouse 2509 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false mint mapk11-mknk2-1 2503 mknk2_mouse 2508 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 mk11_mouse 2510 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false homomint mint mapk3-mknk1 2504 mknk1_mouse 2509 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 mk03_mouse 2511 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false mint mapk3-mknk2 2504 mk03_mouse 2511 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 mknk2_mouse 2508 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false homomint mint mapk11-mknk2 2505 mk11_mouse 2510 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 mknk2_mouse 2508 unspecified role unspecified role unspecified role unspecified role purified purified Stoichiometry: 1.0 phosphorylation phosphorylation reaction phosphorylation false false false homomint mint mapk11-mknk1-1 2506 mk11_mouse 2510 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 mknk1_mouse 2509 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false NFA mint