MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint holm-2001-2 Identification of a structural motif that confers specific interaction with the WD40 repeat domain of Arabidopsis COP1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Holm M., Hardtke CS., Gaudet R., Deng XW. A directed yeast two hybrid assay was used in this study. Figure 1. Figure 5 and Figure 6. xingwang.deng@yale.edu An arabidopsis lambda ACT expression cDNA library was obtained from the Arabidopsis Biological Resource Center and converted to a pACT library prior to screening. EMBO J. (0261-4189) 2001 IMEx Only protein-protein interactions imex curation imex curation holm-2001-1 Identification of a structural motif that confers specific interaction with the WD40 repeat domain of Arabidopsis COP1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Holm M., Hardtke CS., Gaudet R., Deng XW. xingwang.deng@yale.edu An arabidopsis lambda ACT expression cDNA library was obtained from the Arabidopsis Biological Resource Center and converted to a pACT library prior to screening. EMBO J. (0261-4189) 2001 IMEx Only protein-protein interactions imex curation imex curation cop1_arath E3 ubiquitin-protein ligase COP1 COP1 Constitutive photomorphogenesis protein 1 RING-type E3 ubiquitin transferase COP1 T21L14.11 At2g32950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEISTDPVVPAVKPDPRTSSVGEGANRHENDDGGSGGSEIGAPDLDKDLLCPICMQIIKDAFLTACGHSFCYMCIITHLRNKSDCPCCSQHLTNNQLYPNFLLDKLLKKTSARHVSKTASPLDQFREALQRGCDVSIKEVDNLLTLLAERKRKMEQEEAERNMQILLDFLHCLRKQKVDELNEVQTDLQYIKEDINAVERHRIDLYRARDRYSVKLRMLGDDPSTRNAWPHEKNQIGFNSNSLSIRGGNFVGNYQNKKVEGKAQGSSHGLPKKDALSGSDSQSLNQSTVSMARKKRIHAQFNDLQECYLQKRRQLADQPNSKQENDKSVVRREGYSNGLADFQSVLTTFTRYSRLRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVNEPADMQCPIVEMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGSADHHIHYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRTFRGHTNEKNFVGLTVNSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSYFISAVCWKSDSPTMLTANSQGTIKVLVLAA hy5_arath Transcription factor HY5 HY5 BZIP56 At5g11260 F2I11_150 Protein LONG HYPOCOTYL 5 bZIP transcription factor 56 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQEQATSSLAASSLPSSSERSSSSAPHLEIKEGIESDEEIRRVPEFGGEAVGKETSGRESGSATGQERTQATVGESQRKRGRTPAEKENKRLKRLLRNRVSAQQARERKKAYLSELENRVKDLENKNSELEERLSTLQNENQMLRHILKNTTGNKRGGGGGSNADASL q96288-1 B-box zinc finger protein 24 BBX24 STO Salt tolerance protein T21E18.8 T21E18.9 At1g06040 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKIQCDVCEKAPATVICCADEAALCPQCDIEIHAANKLASKHQRLHLNSLSTKFPRCDICQEKAAFIFCVEDRALLCRDCDESIHVANSRSANHQRFLATGIKVALTSTICSKEIEKNQPEPSNNQQKANQIPAKSTSQQQQQPSSATPLPWAVDDFFHFSDIESTDKKGQLDLGAGELDWFSDMGFFGDQINDKALPAAEVPELSVSHLGHVHSYKPMKSNVSHKKPRFETRYDDDDEEHFIVPDLG bbx25_arath B-box zinc finger protein 25 BBX25 Protein SALT TOLERANCE HOMOLOG 1 STH STH1 Salt tolerance-like protein T28P16.13 At2g31380 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKIQCDVCEKAPATLICCADEAALCAKCDVEVHAANKLASKHQRLFLDSLSTKFPPCDICLEKAAFIFCVEDRALLCRDCDEATHAPNTRSANHQRFLATGIRVALSSTSCNQEVEKNHFDPSNQQSLSKPPTQQPAAPSPLWATDEFFSYSDLDCSNKEKEQLDLGELDWLAEMGLFGDQPDQEALPVAEVPELSFSHLAHAHSYNRPMKSNVPNKKQRLEYRYDDEEEHFLVPDLG hy5-cop1-8 Directed yeast two hybrid analysis reveals interaction between HY5 protein and the COP1 protein 1523 N/A 1525 unspecified role unspecified role prey prey P43254:p.Lys422Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Lys550Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Trp467Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false P43254:p.Gly524Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Glu592Arg mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 1526 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false O24646:p.Val43_Pro44delinsAlaAla mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sto-cop1-1 Directed yeast two hybrid analysis reveals interaction between ST0 protein and the COP1 protein 1523 N/A 1527 unspecified role unspecified role bait bait N/A 1525 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Gly524Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Lys422Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Arg465Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Trp467Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Lys550Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Glu592Arg mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sth-cop1-2 Directed yeast two hybrid analysis reveals interaction between STH protein and the COP1 protein 1523 N/A 1528 unspecified role unspecified role bait bait Q9SID1:p.[Val234Ala;Pro235Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 1525 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Gly524Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Arg465Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Trp467Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Lys422Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Lys550Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P43254:p.Glu592Arg mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false sth-cop1-1 Directed yeast two hybrid analysis reveals interaction between STH protein and the COP1 protein 1523 N/A 1528 unspecified role unspecified role bait bait Q9SID1:p.Asp236Lys mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 1525 unspecified role unspecified role prey prey P43254:p.Lys550Glu mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false This interaction demonstrated the probable formation of a salt bridge between COP1 lysine (550) residue and STH aspartic acid (236) residue. hy5-cop1-1 Directed yeast two hybrid analysis reveals interaction between HY5 protein and the COP1 protein 1523 N/A 1525 unspecified role unspecified role prey prey P43254:p.Lys550Glu mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 1526 unspecified role unspecified role bait bait O24646:p.Glu45Lys mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false This interaction demonstrated the probable formation of a salt bridge between COP1 lysine (550) residue and HY5 glutamic acid acid (45) residue. hy5-cop1-2 Directed yeast two hybrid analysis reveals interaction between HY5 protein and the COP1 protein 1523 N/A 1525 unspecified role unspecified role prey prey P43254:p.Lys550Glu mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false N/A 1526 unspecified role unspecified role bait bait O24646:p.Glu45Arg mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false This interaction demonstrated the probable formation of a salt bridge between COP1 lysine (550) residue and HY5 glutamic acid acid (45) residue. cop1-sto-1 Yeast 2 hybrid analysis reveals interaction between COP1 protein and the STO protein 1524 N/A 1525 unspecified role unspecified role bait bait N/A 1527 unspecified role unspecified role prey prey physical association physical association false false false cop1-sth-1 Yeast 2 hybrid analysis reveals interaction between COP1 protein and the STO protein 1524 N/A 1525 unspecified role unspecified role bait bait N/A 1528 unspecified role unspecified role prey prey physical association physical association false false false