MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kanai-2000-1 TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. in vivo in vivo imaging technique imaging technique microscopy predetermined predetermined participant predetermined Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. EMBO J. (0261-4189) 2000 partial coverage rapid curation rapid curation kanai-2000-4 TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. EMBO J. (0261-4189) 2000 partial coverage rapid curation rapid curation kanai-2000-2 TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. EMBO J. (0261-4189) 2000 partial coverage rapid curation rapid curation kanai-2000-3 TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. in vivo in vivo beta lactamase beta lactamase complementation beta lactamase predetermined predetermined participant predetermined Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. EMBO J. (0261-4189) 2000 partial coverage rapid curation rapid curation kanai-2000-5 TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. EMBO J. (0261-4189) 2000 partial coverage rapid curation rapid curation kanai-2000-6 TAZ: a novel transcriptional co-activator regulated by interactions with 14-3-3 and PDZ domain proteins. unknown Unknown pull down pull down predetermined predetermined participant predetermined Kanai F., Marignani PA., Sarbassova D., Yagi R., Hall RA., Donowitz M., Hisaminato A., Fujiwara T., Ito Y., Cantley LC., Yaffe MB. EMBO J. (0261-4189) 2000 partial coverage rapid curation rapid curation wwtr1_human WW domain-containing transcription regulator protein 1 Transcriptional coactivator with PDZ-binding motif WWTR1 TAZ protein protein human Homo sapiens Human MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNINPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL nhrf2_human Na(+)/H(+) exchange regulatory cofactor NHE-RF2 SLC9A3R2 NHERF2 Tyrosine kinase activator protein 1 SRY-interacting protein 1 Solute carrier family 9 isoform A3 regulatory factor 2 NHE3 kinase A regulatory protein E3KARP Sodium-hydrogen exchanger regulatory factor 2 protein protein human Homo sapiens Human MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVDPETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSDLPGSDKDTEDGSAWKQDPFQESGLHLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIFSNF 1433e_sheep 14-3-3 protein epsilon YWHAE Protein kinase C inhibitor protein 1 protein protein sheep Ovis aries (Sheep) Sheep MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner mint runx1_human Runt-related transcription factor 1 RUNX1 AML1 CBFA2 Core-binding factor subunit alpha-2 Acute myeloid leukemia 1 protein Oncogene AML-1 Polyomavirus enhancer-binding protein 2 alpha B subunit SL3-3 enhancer factor 1 alpha B subunit SL3/AKV core-binding factor alpha B subunit protein protein human Homo sapiens Human MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN slc9a3r2-wwtr1 875 wwtr1_human 881 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false PDZ BINDING MOTIF tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 nhrf2_human 882 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false Stoichiometry: 1.0 colocalization colocalization false false false mint wwtr1-ywhae 875 1433e_sheep 883 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed Stoichiometry: 1.0 wwtr1_human 881 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false MOTIF:RSHSSP Stoichiometry: 1.0 colocalization colocalization false false false mint wwtr1-ywhae-1 876 1433e_sheep 883 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 wwtr1_human 881 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false MOTIF:RSHSSP Stoichiometry: 1.0 physical association physical association false false false mint wwtr1-slc9a3r2 876 nhrf2_human 882 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false Stoichiometry: 1.0 wwtr1_human 881 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false PDZ BINDING MOTIF Stoichiometry: 1.0 physical association physical association false false false mint wwtr1-runx1 877 runx1_human 884 unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false MOTIF:PPXY Stoichiometry: 1.0 wwtr1_human 881 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 direct interaction direct interaction false false false mint wwtr1-runx1-1 878 wwtr1_human 881 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 runx1_human 884 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false MOTIF:PPXY Stoichiometry: 1.0 physical association physical association false false false mint wwtr1-ywhae-2 879 1433e_sheep 883 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 wwtr1_human 881 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false MOTIF:RSHSSP Stoichiometry: 1.0 direct interaction direct interaction false false false mint wwtr1-ywhaz 880 1433z_human 1433Z_HUMAN 885 unspecified role unspecified role unspecified role unspecified role wwtr1_human WWTR1_HUMAN 881 unspecified role unspecified role unspecified role unspecified role association association false false false homomint domino mint