MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint narita-1998-1 Bax interacts with the permeability transition pore to induce permeability transition and cytochrome c release in isolated mitochondria. in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Narita M., Shimizu S., Ito T., Chittenden T., Lutz RJ., Matsuda H., Tsujimoto Y. Virus - Publications including interactions involving viral proteins Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1998 narita-1998-2 Bax interacts with the permeability transition pore to induce permeability transition and cytochrome c release in isolated mitochondria. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Narita M., Shimizu S., Ito T., Chittenden T., Lutz RJ., Matsuda H., Tsujimoto Y. Virus - Publications including interactions involving viral proteins Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1998 bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS vdac1_human Voltage-dependent anion-selective channel protein 1 VDAC1 VDAC Outer mitochondrial membrane protein porin 1 Plasmalemmal porin Porin 31HL Porin 31HM protein protein human Homo sapiens Human MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA bax_mouse Apoptosis regulator BAX Bax protein protein mouse Mus musculus Mouse MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG vdac1-bak1 6262 bak_human 6264 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 vdac1_human 6265 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false homomint mint vdac1-bax 6262 vdac1_human 6265 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 bax_mouse 6266 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false homomint mint vdac1-bak1-1 6263 vdac1_human 6265 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 bak_human 6264 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint vdac1-bax-1 6263 bax_mouse 6266 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 vdac1_human 6265 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint