HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html ishido-1998-2 Complex formation of NS5B with NS3 and NS4A proteins of hepatitis C virus. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ishido S., Fujita T., Hotta H. Virus - Publications including interactions involving viral proteins hotta@kobe-u.ac.jp Biochem. Biophys. Res. Commun. (0006-291X) 1998 imex curation Only protein-protein interactions imex curation ishido-1998-1 Complex formation of NS5B with NS3 and NS4A proteins of hepatitis C virus. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Ishido S., Fujita T., Hotta H. Virus - Publications including interactions involving viral proteins hotta@kobe-u.ac.jp Biochem. Biophys. Res. Commun. (0006-291X) 1998 imex curation Only protein-protein interactions imex curation ishido-1998-3 Complex formation of NS5B with NS3 and NS4A proteins of hepatitis C virus. chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ishido S., Fujita T., Hotta H. Virus - Publications including interactions involving viral proteins hotta@kobe-u.ac.jp Biochem. Biophys. Res. Commun. (0006-291X) 1998 imex curation Only protein-protein interactions imex curation p27958-pro_0000037573 Serine protease/helicase NS3 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQTYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPTGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAKGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADAGCSGGAYDIIICDECHSTDATSISGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLGFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMRKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEVVT 1027 1657 p27958-pro_0000037574 Non-structural protein 4A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STWVLVGGVLAALAAYCLSTGCVVIVGRIVLSGKPAIIPDREVLYQEFDEMEEC 1658 1711 p27958-pro_0000037577 RNA-directed RNA polymerase protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SMSYSWTGALVTPCAAEEQKLPINALSNSLLRHHNLVYSTTSRSACQRKKKVTFDRLQVLDSHYQDVLKEVKAAASKVKANLLSVEEACSLAPPHSAKSKFGYGAKDVRCHARKAVAHINSVWKDLLEDSVTPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSKLPLAVMGSSYGFQYSPGQRVEFLVQAWKSKKTPMGLSYDTRCFDSTVTESDIRTEEAIYQCCDLDPQARVAIKSLTERLYVGGPLTNSRGENCGYRRCRASRVLTTSCGNTLTRYIKARAACRAAGLQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPPQPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMFAPTLWARMILMTHFFSVLIARDQLEQALNCEIYGACYSIEPLDLPPIIQRLHGLSAFSLHSYSPGEINRVAACLRKLGVPPLRAWRHRAWSVRARLLARGGKAAICGKYLFNWAVRTKLKLTPITAAGRLDLSGWFTAGYSGGDIYHSVSHARPRWFWFCLLLLAAGVGIYLLPNR 2421 3011 p27958_pro-ns5b-1 1428345 n/a NS3 1428348 unspecified role unspecified role bait bait n/a NS4A 1428349 unspecified role unspecified role prey prey n/a 1428350 unspecified role unspecified role prey prey association association false false false 5 ns3-ns5b-7 1428345 n/a NS3 1428348 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a NS5B 1428350 unspecified role unspecified role prey prey physical association physical association false false false 2 ns3-ns5b-ns4a-1 1428345 n/a NS3 1428348 unspecified role unspecified role prey prey n/a NS5B 1428350 unspecified role unspecified role prey prey n/a NS4A 1428349 unspecified role unspecified role bait bait association association false false false 5 ns3-ns5b-ns4a-3 1428345 n/a NS3 1428348 unspecified role unspecified role prey prey n/a NS5B 1428350 unspecified role unspecified role bait bait n/a NS4A 1428349 unspecified role unspecified role prey prey association association false false false 5 ns4a-ns5b-4 1428345 n/a NS4A 1428349 unspecified role unspecified role bait bait n/a NS5B 1428350 unspecified role unspecified role prey prey physical association physical association false false false 6 ns4a-ns5b-1 1428345 n/a NS4A 1428349 unspecified role unspecified role prey prey n/a NS5B 1428350 unspecified role unspecified role bait bait physical association physical association false false false 6 ns3-ns5b-6 1428346 n/a NS3 1428348 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a NS5B 1428350 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 1 ns3-ns5b-ns4a-2 1428346 n/a NS3 1428348 unspecified role unspecified role neutral component neutral component n/a NS4A 1428349 unspecified role unspecified role neutral component neutral component n/a NS5B 1428350 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4 ns3-ns5b-2 1428347 n/a NS3 1428348 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a NS5B 1428350 unspecified role unspecified role prey prey physical association physical association false false false 3