MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kawaguch-1997-1 Herpes simplex virus 1 alpha regulatory protein ICP0 interacts with and stabilizes the cell cycle regulator cyclin D3. unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kawaguchi Y., Van Sant C., Roizman B. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 1997 rapid curation rapid curation kawaguch-1997-2 Herpes simplex virus 1 alpha regulatory protein ICP0 interacts with and stabilizes the cell cycle regulator cyclin D3. unknown Unknown pull down pull down predetermined predetermined participant predetermined Kawaguchi Y., Van Sant C., Roizman B. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 1997 rapid curation rapid curation kawaguchi-1997-1 Herpes simplex virus 1 alpha regulatory protein ICP0 interacts with and stabilizes the cell cycle regulator cyclin D3. unknown Unknown fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Kawaguchi Y., Van Sant C., Roizman B. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 1997 rapid curation rapid curation icp0_hhv11 E3 ubiquitin-protein ligase ICP0 ICP0 Alpha-0 protein IE110 Immediate-early protein IE110 Trans-acting transcriptional protein ICP0 VMW110 RING-type E3 ubiquitin transferase ICP0 protein protein hhv11 Human herpesvirus 1 (strain 17) (HHV-1) Human herpes simplex virus 1 HHV-1 MEPRPGASTRRPEGRPQREPAPDVWVFPCDRDLPDSSDSEAETEVGGRGDADHHDDDSASEADSTDTELFETGLLGPQGVDGGAVSGGSPPREEDPGSCGGAPPREDGGSDEGDVCAVCTDEIAPHLRCDTFPCMHRFCIPCMKTWMQLRNTCPLCNAKLVYLIVGVTPSGSFSTIPIVNDPQTRMEAEEAVRAGTAVDFIWTGNQRFAPRYLTLGGHTVRALSPTHPEPTTDEDDDDLDDADYVPPAPRRTPRAPPRRGAAAPPVTGGASHAAPQPAAARTAPPSAPIGPHGSSNTNTTTNSSGGGGSRQSRAAAPRGASGPSGGVGVGVGVVEAEAGRPRGRTGPLVNRPAPLANNRDPIVISDSPPASPHRPPAAPMPGSAPRPGPPASAAASGPARPRAAVAPCVRAPPPGPGPRAPAPGAEPAARPADARRVPQSHSSLAQAANQEQSLCRARATVARGSGGPGVEGGHGPSRGAAPSGAAPLPSAASVEQEAAVRPRKRRGSGQENPSPQSTRPPLAPAGAKRAATHPPSDSGPGGRGQGGPGTPLTSSAASASSSSASSSSAPTPAGAASSAAGAASSSASASSGGAVGALGGRQEETSLGPRAASGPRGPRKCARKTRHAETSGAVPAGGLTRYLPISGVSSVVALSPYVNKTITGDCLPILDMETGNIGAYVVLVDQTGNMATRLRAAVPGWSRRTLLPETAGNHVMPPEYPTAPASEWNSLWMTPVGNMLFDQGTLVGALDFRSLRSRHPWSGEQGASTRDEGKQ ccnd3_human G1/S-specific cyclin-D3 CCND3 protein protein human Homo sapiens Human MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL icp0-ccnd3 760191 icp0_hhv11 760194 unspecified role unspecified role bait bait ccnd3_human 760195 unspecified role unspecified role prey prey physical association physical association false false false NFA homomint mint ccnd3-icp0 760192 icp0_hhv11 760194 unspecified role unspecified role prey prey ccnd3_human 760195 unspecified role unspecified role bait bait physical association physical association false false false F6 homomint mint ccnd3-icp0-1 760193 icp0_hhv11 760194 unspecified role unspecified role neutral component neutral component ccnd3_human 760195 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false F7 homomint mint