UniProt UniProt http://www.uniprot.org watanabe-1997-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Watanabe H., Shiratori T., Shoji H., Miyatake S., Okazaki Y., Ikuta K., Sato T., Saito T. Virus - Publications including interactions involving viral proteins n/a Human Jurkat cDNA Biochemical and biophysical research communications 1997 IMEx Viral Nef has been mapped to the UniProt HIV-1 reference strain. Coordinates of the binding site in Nef are variably described in the publication; numbering in fig 3 has been followed. Only protein-protein interactions imex curation imex curation watanabe-1997-5 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Watanabe H., Shiratori T., Shoji H., Miyatake S., Okazaki Y., Ikuta K., Sato T., Saito T. Virus - Publications including interactions involving viral proteins Viral Nef has been mapped to the UniProt HIV-1 reference strain. Coordinates of the binding site in Nef are variably described in the publication; numbering in fig 3 has been followed. n/a Biochemical and biophysical research communications 1997 Only protein-protein interactions imex curation imex curation nef_hv1h2 Protein Nef nef 3'ORF Negative factor protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MGGKWSKSSVIGWPTVRERMRRAEPAADRVGAASRDLEKHGAITSSNTAATNAACAWLEAQEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPDWQNYTPGPGVRYPLTFGWCYKLVPVEPDKIEEANKGENTSLLHPVSLHGMDDPEREVLEWRFDSRLAFHHVARELHPEYFKNC acot8_human Acyl-coenzyme A thioesterase 8 ACOT8 ACTEIII PTE1 Choloyl-coenzyme A thioesterase Peroxisomal acyl-coenzyme A thioester hydrolase 1 Peroxisomal long-chain acyl-CoA thioesterase 1 HIV-Nef-associated acyl-CoA thioesterase Thioesterase II Peroxisomal acyl-CoA thioesterase 2 protein protein human Homo sapiens Human MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL acot8-nef-1 1790418 N/A 1790420 unspecified role unspecified role bait bait N/A 1790421 unspecified role unspecified role prey prey physical association physical association false false false n/a nef-acot8-1 1790419 N/A 1790420 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 1790421 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false 3A and B