MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint prigmore-1995-1 A 68-kDa kinase and NADPH oxidase component p67phox are targets for Cdc42Hs and Rac1 in neutrophils. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Prigmore E., Ahmed S., Best A., Kozma R., Manser E., Segal AW., Lim L. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 1995 prigmore-1995-2 A 68-kDa kinase and NADPH oxidase component p67phox are targets for Cdc42Hs and Rac1 in neutrophils. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Prigmore E., Ahmed S., Best A., Kozma R., Manser E., Segal AW., Lim L. Virus - Publications including interactions involving viral proteins J. Biol. Chem. (0021-9258) 1995 cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL ncf2_human Neutrophil cytosol factor 2 NOXA2 P67PHOX Neutrophil NADPH oxidase factor 2 NADPH oxidase activator 2 67 kDa neutrophil oxidase factor p67-phox NCF2 protein protein human Homo sapiens Human MSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVELRIHPQQQPQEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVKLSVPMPYTLKVHYKYTVVMKTQPGLPYSQVRDMVSKKLELRLEHTKLSYRPRDSNELVPLSEDSMKDAWGQVKNYCLTLWCENTVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEFQEGDIILVLSKVNEEWLEGECKGKVGIFPKVFVEDCATTDLESTRREV e2ak2_human Interferon-induced, double-stranded RNA-activated protein kinase Interferon-inducible RNA-dependent protein kinase Eukaryotic translation initiation factor 2-alpha kinase 2 Protein kinase RNA-activated p68 kinase P1/eIF-2A protein kinase EIF2AK2 PKR PRKR Tyrosine-protein kinase EIF2AK2 protein protein human Homo sapiens Human MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC rac1_canlf Ras-related C3 botulinum toxin substrate 1 RAC1 p21-Rac1 Rac2 protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL mint Plasma membrane-associated small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as secretory processes, phagocytosis of apoptotic cells, epithelial cell polarization and growth-factor induced formation of membrane ruffles ncf2-cdc42 6612 cdc42_human 6614 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 ncf2_human 6615 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint cdc42-eif2ak2 6612 cdc42_human 6614 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 e2ak2_human 6616 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint eif2ak2-rac1 6612 rac1_canfa 6617 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 e2ak2_human 6616 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint rac1-ncf2-4 6612 rac1_canfa 6617 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 ncf2_human 6615 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint ncf2-cdc42-1 6613 ncf2_human 6615 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 cdc42_human 6614 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint rac1-ncf2-5 6613 rac1_canfa 6617 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 ncf2_human 6615 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false homomint mint