IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-2021-6 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K., Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K., Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K., Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K. Coronavirus - Interactions investigated in the context of Coronavirus Virus - Publications including interactions involving viral proteins The authors have stated that the species origin of Flag-RAB7, HA-SNAP29, FLAG-VAMP8 and all VPS39 constructs is Human. huihuili@scu.edu.cn,linyong@cqmu.edu.cn,lukf@scu.edu.cn Cell discovery 2021 Only protein-protein interactions imex curation imex curation zhang-2021-4 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K., Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K., Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K., Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K. Coronavirus - Interactions investigated in the context of Coronavirus Virus - Publications including interactions involving viral proteins The authors have stated that the species origin of Flag-RAB7, HA-SNAP29, FLAG-VAMP8 and all VPS39 constructs is Human. huihuili@scu.edu.cn,linyong@cqmu.edu.cn,lukf@scu.edu.cn Cell discovery 2021 Only protein-protein interactions imex curation imex curation zhang-2021-5 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K., Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K., Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K., Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K. Coronavirus - Interactions investigated in the context of Coronavirus Virus - Publications including interactions involving viral proteins The authors have stated that the species origin of Flag-RAB7, HA-SNAP29, FLAG-VAMP8 and all VPS39 constructs is Human. huihuili@scu.edu.cn,linyong@cqmu.edu.cn,lukf@scu.edu.cn Cell discovery 2021 Only protein-protein interactions imex curation imex curation zhang-2021-7 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K., Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K., Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K., Zhang Y., Sun H., Pei R., Mao B., Zhao Z., Li H., Lin Y., Lu K. Coronavirus - Interactions investigated in the context of Coronavirus Virus - Publications including interactions involving viral proteins The authors have stated that the cell line used in figure S2 was 293T. The authors have stated that the species origin of Flag-RAB7, HA-SNAP29, FLAG-VAMP8 and all VPS39 constructs is Human. huihuili@scu.edu.cn,linyong@cqmu.edu.cn,lukf@scu.edu.cn Cell discovery 2021 Only protein-protein interactions imex curation imex curation rab7a_human Ras-related protein Rab-7a RAB7A RAB7 protein protein human Homo sapiens Human MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC ap3a_sars2 ORF3a protein Accessory protein 3a Protein U274 Protein X1 3a Protein 3a protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFGWLIVGVALLAVFQSASKIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL vps39_human Vam6/Vps39-like protein KIAA0770 VPS39 VAM6 TLP TRAP1-like protein protein protein human Homo sapiens Human MHDAFEPVPILEKLPLQIDCLAAWEEWLLVGTKQGHLLLYRIRKDVVPADVASPESGSCNRFEVTLEKSNKNFSKKIQQIHVVSQFKILVSLLENNIYVHDLLTFQQITTVSKAKGASLFTCDLQHTETGEEVLRMCVAVKKKLQLYFWKDREFHELQGDFSVPDVPKSMAWCENSICVGFKRDYYLIRVDGKGSIKELFPTGKQLEPLVAPLADGKVAVGQDDLTVVLNEEGICTQKCALNWTDIPVAMEHQPPYIIAVLPRYVEIRTFEPRLLVQSIELQRPRFITSGGSNIIYVASNHFVWRLIPVPMATQIQQLLQDKQFELALQLAEMKDDSDSEKQQQIHHIKNLYAFNLFCQKRFDESMQVFAKLGTDPTHVMGLYPDLLPTDYRKQLQYPNPLPVLSGAELEKAHLALIDYLTQKRSQLVKKLNDSDHQSSTSPLMEGTPTIKSKKKLLQIIDTTLLKCYLHTNVALVAPLLRLENNHCHIEESEHVLKKAHKYSELIILYEKKGLHEKALQVLVDQSKKANSPLKGHERTVQYLQHLGTENLHLIFSYSVWVLRDFPEDGLKIFTEDLPEVESLPRDRVLGFLIENFKGLAIPYLEHIIHVWEETGSRFHNCLIQLYCEKVQGLMKEYLLSFPAGKTPVPAGEEEGELGEYRQKLLMFLEISSYYDPGRLICDFPFDGLLEERALLLGRMGKHEQALFIYVHILKDTRMAEEYCHKHYDRNKDGNKDVYLSLLRMYLSPPSIHCLGPIKLELLEPKANLQAALQVLELHHSKLDTTKALNLLPANTQINDIRIFLEKVLEENAQKKRFNQVLKNLLHAEFLRVQEERILHQQVKCIITEEKVCMVCKKKIGNSAFARYPNGVVVHYFCSKEVNPADT vamp8_human Vesicle-associated membrane protein 8 Endobrevin VAMP8 protein protein human Homo sapiens Human MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVLICVIVFIIILFIVLFATGAFS snp29_human Synaptosomal-associated protein 29 Vesicle-membrane fusion protein SNAP-29 Soluble 29 kDa NSF attachment protein SNAP29 protein protein human Homo sapiens Human MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL ap3a_sars2-vps39-6 4055777 N/A 4055781 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4055782 inhibitor inhibitor prey prey over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4055783 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 5I Orf3a expression dramatically reduced the interaction between RAB7 and VPS39. vps39-rab7a-1 4055777 N/A 4055781 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4055783 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5I snap29-vamp8-1 4055777 N/A 4055784 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4055785 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5J ORF3a - P0DTC3. ap3a_sars2-vps39-2 4055778 N/A 4055782 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 4055783 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false 5B ap3a_sars2-vps39-5 4055779 N/A 4055782 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P0DTC3:p.Tyr160Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 4055783 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 5 E/G ap3a_sars2-vps39-7 4055780 N/A 4055782 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P0DTC3:p.Tyr160Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false N/A 4055783 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supplementary figure 2 A/B The authors have stated that 293T was the cell line used in Figure S2.