IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lenza-2020-1 in vitro In vitro solution nmr solution state nmr solution state nmr solution nmr predetermined predetermined participant predetermined Lenza MP., Oyenarte I., Diercks T., Quintana JI., Gimeno A., Bosch A., Coelho H., Diniz A., Peccati F., Delgado S., Valle M., Millet O., Abrescia NGA., Palazón A., Marcelo F., Jimenez-Oses G., Jimenez-Barbero J., Arda A., Ereño-Orbea J. Virus - Publications including interactions involving viral proteins Radiolabelling of the N-glycans on Spike RBD was achieved by adding 13C D-glucose to transfected HEK293F cells. MGL was identified as CLEC10A from pmid:30504228 aarda@cicbiogune.es,jjbarbero@cicbiogune.es,jereno@cicbiogune.es The aarda email address was hyperlinked so I assume this must be the (main?) corresponding author - not stated. Angewandte Chemie (International ed. in English) 2020 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus leg3_human Galectin-3 LGALS3 MAC2 Galactose-specific lectin 3 Mac-2 antigen IgE-binding protein 35 kDa lectin Carbohydrate-binding protein 35 Laminin-binding protein Lectin L-29 L-31 Galactoside-binding protein protein protein human Homo sapiens Human MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT leg7_human Galectin-7 LGALS7 PIG1 HKL-14 PI7 p53-induced gene 1 protein LGALS7B protein protein human Homo sapiens Human MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF leg8_human Galectin-8 LGALS8 Prostate carcinoma tumor antigen 1 Po66 carbohydrate-binding protein protein protein human Homo sapiens Human MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW cd209_human CD209 antigen CD209 CLEC4L C-type lectin domain family 4 member L Dendritic cell-specific ICAM-3-grabbing non-integrin 1 protein protein human Homo sapiens Human MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA clc10_human C-type lectin domain family 10 member A CLEC10A CLECSF13 CLECSF14 HML C-type lectin superfamily member 14 Macrophage lectin 2 protein protein human Homo sapiens Human MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH sig10_human Sialic acid-binding Ig-like lectin 10 SIGLEC10 SLG2 Siglec-like protein 2 UNQ477/PRO940 protein protein human Homo sapiens Human MLLPLLLSSLLGGSQAMDGRFWIRVQESVMVPEGLCISVPCSFSYPRQDWTGSTPAYGYWFKAVTETTKGAPVATNHQSREVEMSTRGRFQLTGDPAKGNCSLVIRDAQMQDESQYFFRVERGSYVRYNFMNDGFFLKVTALTQKPDVYIPETLEPGQPVTVICVFNWAFEECPPPSFSWTGAALSSQGTKPTTSHFSVLSFTPRPQDHNTDLTCHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYLEAQKGQFLRLLCAADSQPPATLSWVLQNRVLSSSHPWGPRPLGLELPGVKAGDSGRYTCRAENRLGSQQRALDLSVQYPPENLRVMVSQANRTVLENLGNGTSLPVLEGQSLCLVCVTHSSPPARLSWTQRGQVLSPSQPSDPGVLELPRVQVEHEGEFTCHARHPLGSQHVSLSLSVHYSPKLLGPSCSWEAEGLHCSCSSQASPAPSLRWWLGEELLEGNSSQDSFEVTPSSAGPWANSSLSLHGGLSSGLRLRCEAWNVHGAQSGSILQLPDKKGLISTAFSNGAFLGIGITALLFLCLALIIMKILPKRRTQTETPRPRFSRHSTILDYINVVPTAGPLAQKRNQKATPNSPRTPLPPGAPSPESKKNQKKQYQLPSFPEPKSSTQAPESQESQEELHYATLNFPGVRPRPEARMPKGTQADYAEVKFQ mint n-acetyllactosamine N-acetyllactosamine beta-D-Galactosyl-1,4-N-acetyl-D-glucosamine Galb1-4GlcNAcb Galbeta1-4GlcNAcbeta LacNAc N-acetyl-beta-lactosamine N-Acetyllactosamine beta-D-galactopyranosyl-(1->4)-2-acetamido-2-deoxy-beta-D-glucopyranose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 3'sln 3'SLN small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) n-acetylgalactosamine N-acetylgalactosamine GalNAc 2-Acetamido-2-deoxygalactose N-Acetylchondrosamine N-Acetylgalactosamine 2-acetamido-2-deoxygalactose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) lgals3-s-1 3930680 N/A 3930681 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3930682 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction false false false 3 and 4 Spike N-linked glycans:- Intensity attenuation was more pronounced for peaks from LDN, LacNAc and 3'SLacNAc (3'SLN). (GalNAc-beta1-4GlcNAc [CHEBI:61190], N-acetyllactosamine [CHEBI:16153 ], alpha-2,3-sialyl-N-acetyllactosamine [CHEBI:156513], respectively) lgals7b-s-1 3930680 N/A 3930683 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3930682 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction false false false 4 Spike N-linked glycans:-the most perturbed signals correspond to the LDN epitope, with those for LN and 3´SLN also affected to a lesser extent. (GalNAc-beta1-4GlcNAc [CHEBI:61190], N-acetyllactosamine [CHEBI:16153 ], alpha-2,3-sialyl-N-acetyllactosamine [CHEBI:156513], respectively) lgals8-s-1 3930680 N/A 3930684 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3930682 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction false false false 4 Galectin-8 binds mainly to the 3´SLN epitope (alpha-2,3-sialyl-N-acetyllactosamine [CHEBI:156513]) of the Spike RBD. cd209-s-9 3930680 N/A 3930685 unspecified role unspecified role neutral component neutral component N/A 3930682 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction false false false 4,7 Spike N-linked glycans:- DC-SIGN exhibited selectivity for the two fucosylated terminal epitopes LeX and LDNF. (LewisX:1,4-beta-D-galactopyranosyl-(alpha-1,3-L-fucopyranosyl)-N-acetyl-D-glucosaminyl group [CHEBI:17995] and fucosylated LDN [CHEBI:61864], respectively) clec10a-s-3 3930680 N/A 3930686 unspecified role unspecified role neutral component neutral component purified purified possible his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false lectin domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3930682 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction false false false 4,7 Spike N-linked glycans:- MGL recognised terminal LDN, its alpha-2-6 sialylated version (6´SLDN), and the fucosylated LDN (LDNF) glycans. (LDN=GalNAc-beta1-4GlcNAc,[CHEBI:61190], 6´SLDN = CHEBI:156514], LDNF=CHEBI:61864], In Figure 1 MGL is stated to have a preference for N-acetyl-galactosamine. s-siglec10-1 3930680 N/A 3930687 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f N/A 3930682 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false region 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction false false false 4,6 Spike N-linked glycans:- A marked reduction of the cross-peak intensities was seen with terminal 3´SLN and 6´SLN (6'SLacNAc) epitopes. ( alpha-2,3-sialyl-N-acetyllactosamine [CHEBI:156513], and alpha-2,6-linked sialyl -N-acetyllactosamine (6'SLacNAc [CHEBI:17725].) lgals3-s-2 3930680 N/A 3930681 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3930682 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction false false false 5 Spike N-linked glycans:- Intensity attenuation was more pronounced for peaks from LDN, LacNAc and 3'SLacNAc (3'SLN). (GalNAc-beta1-4GlcNAc [CHEBI:61190], N-acetyllactosamine [CHEBI:16153 ], alpha-2,3-sialyl-N-acetyllactosamine [CHEBI:156513], respectively) lactose-lgals3-1 3930680 N/A 3930681 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3930688 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 3930680 Figure 1B, Supp. figure 3, number 1 Text states that:- "The T175-N179 region is hardly modified by LacNAc, but greatly perturbed when LacNAc is alpha-2-3 sialylated." 3'sln-lgals3-1 3930680 N/A 3930681 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3930689 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Supp. figure 3, number 2 Text states that:- "The T175-N179 region is hardly modified by LacNAc, but greatly perturbed when LacNAc is alpha-2-3 sialylated." lgals8-s-2 3930680 N/A 3930684 unspecified role unspecified role neutral component neutral component purified purified region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3930682 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction false false false Supp. figure 4 Galectin-8 binds mainly to the 3´SLN epitope (alpha-2,3-sialyl-N-acetyllactosamine [CHEBI:156513]) of the Spike RBD. lgals7b-s-2 3930680 N/A 3930683 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3930682 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction false false false Supp. figure 5 Most of the protein is affected by the interaction. cd209-s-10 3930680 N/A 3930685 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3930682 unspecified role unspecified role neutral component neutral component purified purified Asn-343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Asn-331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction false false false Supp. figure 7 Spike N-linked glycans:- DC-SIGN exhibited selectivity for the two fucosylated terminal epitopes LeX and LDNF. (LewisX:1,4-beta-D-galactopyranosyl-(alpha-1,3-L-fucopyranosyl)-N-acetyl-D-glucosaminyl group [CHEBI:17995] and fucosylated LDN [CHEBI:61864], respectively) clec10a-s-4 3930680 N/A 3930686 unspecified role unspecified role neutral component neutral component purified purified possible his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false lectin domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3930682 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction false false false Supp. Figure 8 Spike N-linked glycans:- MGL recognised terminal LDN, its alpha-2-6 sialylated version (6´SLDN), and the fucosylated LDN (LDNF) glycans. (LDN=GalNAc-beta1-4GlcNAc,[CHEBI:61190], 6´SLDN = CHEBI:156514], LDNF=CHEBI:61864], In Figure 1 MGL is stated to have a preference for N-acetyl-galactosamine. Addition of 1 RBD equivalent produced the complete disappearance of all the NMR signals. clec10a-s-5 3930680 N/A 3930690 competitor competitor competitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3930686 unspecified role unspecified role neutral component neutral component purified purified possible his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false lectin domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3930682 unspecified role unspecified role neutral component neutral component purified purified Asn343 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false RBD_Sb domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Asn331 n4glycoasn N4-glycosyl-L-asparagine N4GlycoAsn certain certain sequence position certain certain certain sequence position certain false human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction false false false Supp. Figure 9 In Figure 1 MGL is stated to have a preference for N-acetyl-galactosamine. The addition of 1 equivalent of GalNAc produced recovery of the NMR signals of the lectin, confirming that the RBD and GalNAc compete for the same binding site.