HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html li-2016-7 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li H., Zhang C., Cui H., Guo K., Wang F., Zhao T., Liang W., Lv Q., Zhang Y. Virus - Publications including interactions involving viral proteins zcc87051007@126.com Virus genes 2016 imex curation Only protein-protein interactions imex curation li-2016-8 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Li H., Zhang C., Cui H., Guo K., Wang F., Zhao T., Liang W., Lv Q., Zhang Y. Virus - Publications including interactions involving viral proteins zcc87051007@126.com Virus genes 2016 imex curation Only protein-protein interactions imex curation li-2016-9 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Li H., Zhang C., Cui H., Guo K., Wang F., Zhao T., Liang W., Lv Q., Zhang Y. Virus - Publications including interactions involving viral proteins zcc87051007@126.com Virus genes 2016 imex curation Only protein-protein interactions imex curation p19712-pro_0000038060 Non-structural protein 5A protein protein CSFV Classical swine fever virus (strain Alfort) Hog cholera virus SSNYILELLYKFRDNIKSSVREIAISWAPAPFSCDWTPTDDRIGLPHENYLRVETKCPCGYRMKAVKNCAGELRLLEEGGSFLCRNKFGRGSQNYRVTKYYDDNLSEIKPVIRMEGHVELYYKGATIKLDFNNSKTVLATDKWEVDHSTLVRALKRYTGAGYRGAYLGEKPNHKHLIQRDCATITKDKVCFIKMKRGCAFTYDLSLHNLTRLIELVHKNNLEDREIPAVTVTTWLAYTFVNEDIGTIKPTFGEKVTPEKQEEVVLQPAVVVDTTDVAVTVVGETSTMTTGETPTTFTSLGSDSKVRQVLKLGVDDGQYPGPNQQRASLLEAIQGVDERPSVLILGSDKATSNRVKTAKNVKIYRSRDPLELREMMKRGKILVVALSRVDTALLKFVDYKGTFLTRETLEALSLGKPKKRDITKAEAQWLLRLEDQIEELPDWFAAKEPIFLEANIKRDKYHLVGDIATIKEKAKQLGATDSTKISKEVGAKVYSMKL 2684 3180 f1s912_pig Peptidylprolyl isomerase FKBP8 protein protein pig Sus scrofa (Pig) Pig MASCAEPSAAGPEPTAPPPTGAPPLEDFEVLDGVEDAEGEEEEEEEEEDLSELPPLEDVGQPPVEEAEQPGALAREFLAAMEPEPEPAPAPDEWLDILGNGLLRKKTLVPGPPGSSRPTKGQVVTVQLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKAAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEEQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN ns5a-fkbp8-8 2845858 N/A 2845861 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2845862 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A fkbp8-1 2845858 N/A 2845861 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2845862 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B ns5a-fkbp8-11 2845859 N/A 2845861 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 2845862 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 2 fkbp8-ns5a-13 2845860 N/A 2845862 unspecified role unspecified role neutral component neutral component purified purified RED tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 2845861 unspecified role unspecified role neutral component neutral component c terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. colocalization colocalization false false false 3