IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ shi-2014-12 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins jkehrl@niaid.nih.gov Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus shi-2014-13 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins jkehrl@niaid.nih.gov Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus shi-2014-14 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins Myc-MAVS has been entered as being of Human origin due to sequence length. jkehrl@niaid.nih.gov Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus shi-2014-15 human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins jkehrl@niaid.nih.gov Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus shi-2014-16 human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma super-resolution microscopy Super-resolution microscopy super resolution microscopy super-resolution microscopy immunocytochemistry immunocytochemistry Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins STED microscopy (Stimulated emission depletion (STED) microscopy) ;it creates super-resolution images by the selective deactivation of fluorophores, minimising the area of illumination at the focal point, and thus enhancing the achievable resolution for a given system. jkehrl@niaid.nih.gov Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus shi-2014-17 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy immunocytochemistry immunocytochemistry Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH., Shi CS., Qi HY., Boularan C., Huang NN., Abu-Asab M., Shelhamer JH., Kehrl JH. Virus - Publications including interactions involving viral proteins 10 nm and 20 nm Gold-conjugated secondary antibodies were used. jkehrl@niaid.nih.gov Journal of immunology (Baltimore, Md. : 1950) 2014 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus dnm1l_human Dynamin-1-like protein Dynamin-like protein Dnm1p/Vps1p-like protein Dynamin family member proline-rich carboxyl-terminal domain less Dynamin-related protein 1 Dynamin-like protein 4 Dynamin-like protein IV DNM1L DLP1 DRP1 protein protein human Homo sapiens Human MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW F9521A376B785B71 orf9b_sars ORF9b protein Protein 9b 9b Accessory protein 9b ORF-9b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK mavs_human Mitochondrial antiviral-signaling protein Interferon beta promoter stimulator protein 1 Virus-induced-signaling adapter CARD adapter inducing interferon beta Putative NF-kappa-B-activating protein 031N MAVS IPS1 KIAA1271 VISA protein protein human Homo sapiens Human MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFNTLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPPTPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRLPGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPTTLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVPSKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH pcbp2_human Poly(rC)-binding protein 2 PCBP2 Alpha-CP2 Heterogeneous nuclear ribonucleoprotein E2 protein protein human Homo sapiens Human MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWGLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETGGMGSS dnm1l-orf9b_cvhsa-1 3711147 N/A 3711153 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3711154 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2C dnm1l-orf9b_cvhsa-2 3711147 N/A 3711155 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3711156 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3711154 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false association association false false false 6B orf9b_cvhsa-mavs-1 3711148 N/A 3711155 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3711154 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3G mavs-orf9b_cvhsa-1 3711149 N/A 3711155 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3711154 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3H orf9b_cvhsa-mavs-2 3711150 N/A 3711155 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3711154 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false 4A mavs-orf9b_cvhsa-2 3711151 N/A 3711155 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3711154 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false 4B mavs-orf9b_cvhsa-3 3711152 N/A 3711155 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3711154 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 4 C/D