IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ jimenez_guardeo-2014-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Jimenez-Guardeño JM., Nieto-Torres JL., DeDiego ML., Regla-Nava JA., Fernandez-Delgado R., Castaño-Rodriguez C., Enjuanes L. Virus - Publications including interactions involving viral proteins L.Enjuanes@cnb.csic.es human lung cDNA PLoS pathogens 2014 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus jimenez_guardeo-2014-2 chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jimenez-Guardeño JM., Nieto-Torres JL., DeDiego ML., Regla-Nava JA., Fernandez-Delgado R., Castaño-Rodriguez C., Enjuanes L. Virus - Publications including interactions involving viral proteins L.Enjuanes@cnb.csic.es PLoS pathogens 2014 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus jimenez_guardeo-2014-3 chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Jimenez-Guardeño JM., Nieto-Torres JL., DeDiego ML., Regla-Nava JA., Fernandez-Delgado R., Castaño-Rodriguez C., Enjuanes L. Virus - Publications including interactions involving viral proteins L.Enjuanes@cnb.csic.es PLoS pathogens 2014 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus jimenez_guardeo-2014-4 chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Jimenez-Guardeño JM., Nieto-Torres JL., DeDiego ML., Regla-Nava JA., Fernandez-Delgado R., Castaño-Rodriguez C., Enjuanes L. Virus - Publications including interactions involving viral proteins L.Enjuanes@cnb.csic.es PLoS pathogens 2014 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus o00560-1 Syntenin-1 SDCBP MDA9 Melanoma differentiation-associated protein 9 Pro-TGF-alpha cytoplasmic domain-interacting protein 18 SYCL Scaffold protein Pbp1 Syndecan-binding protein 1 protein protein human Homo sapiens Human MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV vemp_sars Envelope small membrane protein E sM 4 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV e-sdcbp-1 3711759 N/A 3711763 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3711764 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false no figure e-sdcbp-2 3711760 N/A 3711763 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3711764 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed infection infection PBM domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false P59637:p.Asp73_Val76delinsGlyGlyGlyGly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P59637:p.[Glu69Ala;Val71Ala;Asp73Ala;Leu75Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 5c sdcbp-e-1 3711761 N/A 3711763 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3711764 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed infection infection fixed cell fixed cell P59637:p.Asp73_Val76delinsGlyGlyGlyGly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Fig. 6a-b sdcbp-e-2 3711762 N/A 3711763 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3711764 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed infection infection PBM domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false P59637:p.Asp73_Val76delinsGlyGlyGlyGly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P59637:p.[Glu69Ala;Val71Ala;Asp73Ala;Leu75Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 5c