IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ upadhyay-2014-1 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F., Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F. Virus - Publications including interactions involving viral proteins Tetracycline (Tet)-inducible HEK293 cell line expressing FLAG-tagged wt viperin. anna.overby@climi.umu.se,friedemann.weber@staff.uni-marburg.de Cellular microbiology 2014 imex curation Only protein-protein interactions upadhyay-2014-2 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F., Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F. Virus - Publications including interactions involving viral proteins Cells were treated with IFN-alpha. anna.overby@climi.umu.se,friedemann.weber@staff.uni-marburg.de Cellular microbiology 2014 imex curation Only protein-protein interactions upadhyay-2014-3 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip tag visualisation tag visualisation Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F., Upadhyay AS., Vonderstein K., Pichlmair A., Stehling O., Bennett KL., Dobler G., Guo JT., Superti-Furga G., Lill R., Överby AK., Weber F. Virus - Publications including interactions involving viral proteins anna.overby@climi.umu.se,friedemann.weber@staff.uni-marburg.de Cellular microbiology 2014 imex curation Only protein-protein interactions ciao1_human Probable cytosolic iron-sulfur protein assembly protein CIAO1 WD repeat-containing protein 39 CIAO1 WDR39 CIA1 protein protein human Homo sapiens Human MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL rsad2_human Radical S-adenosyl methionine domain-containing protein 2 RSAD2 CIG5 Cytomegalovirus-induced gene 5 protein Viperin Virus inhibitory protein, endoplasmic reticulum-associated, interferon-inducible protein protein human Homo sapiens Human MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW iron iron small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 56q4yaedgr-1 2867689 N/A 2867692 unspecified role unspecified role prey prey N/A 2867693 unspecified role unspecified role bait bait Q8WXG1:p.Trp361del mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q8WXG1:p.Trp361Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q8WXG1:p.[Cys83Ala;Cys87Ala;Cys90Ala] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 6A, 7A rsad2-ciao1-1 2867690 N/A 2867692 unspecified role unspecified role prey prey N/A 2867693 unspecified role unspecified role bait bait physical association physical association false false false 6B rsad2-ciao1-2 2867691 N/A 2867694 unspecified role unspecified role prey prey 55Fe radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2867693 unspecified role unspecified role bait bait Q8WXG1:p.Trp361Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q8WXG1:p.[Cys83Ala;Cys87Ala;Cys90Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 7D, 8D CIAO1 depletion