IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhang-2013g-1 Deubiquitinases sharpen substrate discrimination during membrane protein degradation from the ER. human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang Z.R., Bonifacino J.S., Hegde R.S. Virus - Publications including interactions involving viral proteins Exact cell line used in this experiment was not clear however all cell lines used by the author are of human origin. Interactions involving CK2 could not be captured as there was not enough detail on the manufacturers website to map the subunits. Interactions involving BTRC could not be captured as the origin of this protein could not be traced. zairong.zhang@gmail.com, rhegde@mrc-lmb.cam.ac.uk Cell (0092-8674) 2013 Only protein-protein interactions imex curation zhang-2013g-2 Deubiquitinases sharpen substrate discrimination during membrane protein degradation from the ER. human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Z.R., Bonifacino J.S., Hegde R.S. Virus - Publications including interactions involving viral proteins Exact cell line used in this experiment was not clear however all cell lines used by the author are of human origin. Interactions involving CK2 could not be captured as there was not enough detail on the manufacturers website to map the subunits. Interactions involving BTRC could not be captured as the origin of this protein could not be traced. zairong.zhang@gmail.com, rhegde@mrc-lmb.cam.ac.uk Cell (0092-8674) 2013 Only protein-protein interactions imex curation zhang-2013g-3 Deubiquitinases sharpen substrate discrimination during membrane protein degradation from the ER. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhang Z.R., Bonifacino J.S., Hegde R.S. Virus - Publications including interactions involving viral proteins Exact cell line used in this experiment was not clear however all cell lines used by the author are of human origin. Interactions involving CK2 could not be captured as there was not enough detail on the manufacturers website to map the subunits. Interactions involving BTRC could not be captured as the origin of this protein could not be traced. zairong.zhang@gmail.com, rhegde@mrc-lmb.cam.ac.uk Cell (0092-8674) 2013 Only protein-protein interactions imex curation zhang-2013g-4 Deubiquitinases sharpen substrate discrimination during membrane protein degradation from the ER. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang Z.R., Bonifacino J.S., Hegde R.S. Virus - Publications including interactions involving viral proteins Exact cell line used in this experiment was not clear however all cell lines used by the author are of human origin. Proteins are incorporated into liposomes Interactions involving CK2 could not be captured as there was not enough detail on the manufacturers website to map the subunits. Interactions involving BTRC could not be captured as the origin of this protein could not be traced. zairong.zhang@gmail.com, rhegde@mrc-lmb.cam.ac.uk Cell (0092-8674) 2013 Only protein-protein interactions imex curation vpu_hv1h2 Protein Vpu vpu U ORF protein Viral protein U protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 QPIPIVAIVALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVEMGHHAPWDVDDL cd4_human T-cell surface glycoprotein CD4 CD4 T-cell surface antigen T4/Leu-3 protein protein human Homo sapiens Human MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI cul1_human Cullin-1 CUL1 protein protein human Homo sapiens Human MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA fbw1a_human F-box/WD repeat-containing protein 1A BTRC BTRCP FBW1A FBXW1A F-box and WD repeats protein beta-TrCP E3RSIkappaB pIkappaBalpha-E3 receptor subunit Epididymis tissue protein Li 2a protein protein human Homo sapiens Human MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDCNNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLASTAMKTENCVAKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTYTYISR cd4-vpu-1 1446173 n/a 1446177 unspecified role unspecified role prey prey c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P05919:p.[Ser52Asn;Ser56Asn] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1446178 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false Supp. fig. 1F cd4-vpu-2 1446174 n/a 1446178 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection cytoplasmic region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1446177 unspecified role unspecified role bait bait P05919:p.[Ile17Phe;Val21Phe;Val25Leu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P05919:p.[Ser52Asn;Ser56Asn] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 1C, 1D, Supp. Fig. 1G vpu-btrc-3 1446175 n/a 1446177 unspecified role unspecified role bait bait P05919:p.[Ser52Asn;Ser56Asn] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1446179 unspecified role unspecified role prey prey n/a 1446180 unspecified role unspecified role prey prey association association false false false Fig. 2A, Supp Fig. 2A vpu-cd4-2 1446176 n/a 1446178 autoradiography autoradiography unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection P01730:p.Pro393Met mutation mutation certain certain sequence position certain certain certain sequence position certain false region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro n/a 1446177 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false in vitro In vitro physical association physical association false false false Fig. 3C When CD4 and Vpu were coincorporated into the same liposomes, they interacted with each other, mixing separate liposomes each containing CD4 or Vpu resulted in minimal interaction