HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html neveu-2012-3 Identification and targeting of an interaction between a tyrosine motif within hepatitis C virus core protein and AP2M1 essential for viral assembly. human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Neveu G., Barouch-Bentov R., Ziv-Av A., Gerber D., Jacob Y., Einav S. Virus - Publications including interactions involving viral proteins seinav@stanford.edu PLoS Pathog. (1553-7366) 2012 imex curation Only protein-protein interactions imex curation neveu-2012-4 Identification and targeting of an interaction between a tyrosine motif within hepatitis C virus core protein and AP2M1 essential for viral assembly. human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells confocal microscopy confocal microscopy immunostaining immunostaining Neveu G., Barouch-Bentov R., Ziv-Av A., Gerber D., Jacob Y., Einav S. Virus - Publications including interactions involving viral proteins seinav@stanford.edu PLoS Pathog. (1553-7366) 2012 imex curation Only protein-protein interactions imex curation neveu-2012-1 Identification and targeting of an interaction between a tyrosine motif within hepatitis C virus core protein and AP2M1 essential for viral assembly. in vitro In vitro affinity techniques affinity technology affinity techniques tag fluorescence tag visualisation by fluorescence tag fluorescence Neveu G., Barouch-Bentov R., Ziv-Av A., Gerber D., Jacob Y., Einav S. Virus - Publications including interactions involving viral proteins seinav@stanford.edu PLoS Pathog. (1553-7366) 2012 imex curation Only protein-protein interactions imex curation neveu-2012-2 Identification and targeting of an interaction between a tyrosine motif within hepatitis C virus core protein and AP2M1 essential for viral assembly. human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells split luciferase complementation split luciferase complementation tag luciferase tag visualisation by luciferase assay tag luciferase Neveu G., Barouch-Bentov R., Ziv-Av A., Gerber D., Jacob Y., Einav S. Virus - Publications including interactions involving viral proteins seinav@stanford.edu PLoS Pathog. (1553-7366) 2012 imex curation Only protein-protein interactions imex curation ap2m1_human AP-2 complex subunit mu Adaptor protein complex AP-2 subunit mu AP-2 mu chain AP2M1 CLAPM1 KIAA0109 Adaptin-mu2 Plasma membrane adaptor AP-2 50 kDa protein HA2 50 kDa subunit Clathrin coat assembly protein AP50 Clathrin coat-associated protein AP50 Clathrin assembly protein complex 2 mu medium chain Adaptor-related protein complex 2 subunit mu protein protein human Homo sapiens Human MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC p27958-pro_0000037566 Core protein precursor protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGYPWPLYGNEGCGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVPASA 2 191 q99ib8-pro_0000045596 Envelope glycoprotein E2 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV GTTTVGGAVARSTNVIAGVFSHGPQQNIQLINTNGSWHINRTALNCNDSLNTGFLAALFYTNRFNSSGCPGRLSACRNIEAFRIGWGTLQYEDNVTNPEDMRPYCWHYPPKPCGVVPARSVCGPVYCFTPSPVVVGTTDRRGVPTYTWGENETDVFLLNSTRPPQGSWFGCTWMNSTGFTKTCGAPPCRTRADFNASTDLLCPTDCFRKHPDATYIKCGSGPWLTPKCLVHYPYRLWHYPCTVNFTIFKIRMYVGGVEHRLTAACNFTRGDRCDLEDRDRSQLSPLLHSTTEWAILPCTYSDLPALSTGLLHLHQNIVDVQYMYGLSPAITKYVVRWEWVVLLFLLLADARVCACLWMLILLGQAEA 384 750 q99ib8-pro_0000045592 Core protein precursor protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV STNPKPQRKTKRNTNRRPEDVKFPGGGQIVGGVYLLPRRGPRLGVRTTRKTSERSQPRGRRQPIPKDRRSTGKAWGKPGRPWPLYGNEGLGWAGWLLSPRGSRPSWGPTDPRHRSRNVGKVIDTLTCGFADLMGYIPVVGAPLSGAARAVAHGVRVLEDGVNYATGNLPGFPFSIFLLALLSCITVPVSA 2 191 ap2m1-core-1 1440603 n/a AP2M1 1440607 unspecified role unspecified role bait bait n/a Core 1440608 unspecified role unspecified role prey prey substitution of YXXW motif (W is a bulky hydrophobic residue) with YTPL and YRRL sequences increased the rate of core-AP2M1 binding. physical association physical association false false false Fig. 2D Calyculin A (an inhibitor of AP2M1 dephosphorylation) p27958_core-1 1440603 n/a Core 1440608 unspecified role unspecified role bait bait substitution of YXXW motif (W is a bulky hydrophobic residue) with YTPL and YRRL sequences increased the rate of core-AP2M1 binding. n/a AP2M1 1440607 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2D ap2m1-core-2 1440604 n/a AP2M1 1440607 unspecified role unspecified role neutral component neutral component n/a Core 1440608 unspecified role unspecified role neutral component neutral component P27958-PRO_0000037566:p.Tyr135Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false substitution of YXXW motif (W is a bulky hydrophobic residue) with YTPL and YRRL sequences increased the rate of core-AP2M1 binding. colocalization colocalization false false false Fig. 2E, 5D, 5F, 5I and 5J core-e2-3 1440604 n/a E2 1440609 unspecified role unspecified role neutral component neutral component n/a Core 1440610 unspecified role unspecified role neutral component neutral component Q99IB8-PRO_0000045592:p.Tyr135Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false substitution of YXXW motif (W is a bulky hydrophobic residue) with YTPL and YRRL sequences increased the rate of core-AP2M1 binding. colocalization colocalization false false false Fig. 5O and 5P core-ap2m1-1 1440605 n/a AP2M1 1440607 unspecified role unspecified role bait bait fitc labelled fitc labelled fluorescein isothiocyanate label fluorescein isothiocyanate labbeled FITC labelled FITC labelled fluorescein isothiocyanate labbeled fitc labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a Core 1440610 unspecified role unspecified role prey prey t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cy3 label cy3 label cy3 label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1E and 1F core-ap2m1-2 1440606 n/a Core 1440608 unspecified role unspecified role bait bait P27958-PRO_0000037566:p.Val139Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P27958-PRO_0000037566:p.Ile136Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false renilla-c tag renilla-c renilla-c undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false substitution of YXXW motif (W is a bulky hydrophobic residue) with YTPL and YRRL sequences increased the rate of core-AP2M1 binding. n/a AP2M1 1440607 unspecified role unspecified role prey prey Q96CW1:p.Thr156Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false renilla-n renilla-n renilla-n undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2B, 3A, 6B