IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ nguyen-2012-1 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Nguyen TT., Woo HJ., Kang HK., Nguyen VD., Kim YM., Kim DW., Ahn SA., Xia Y., Kim D. Virus - Publications including interactions involving viral proteins FRET based assay, with substrate Dabcyl-KTSAVLQSGFRKME-Edans peptide. A complementary fluorophore (EDANS) and quencher (DABCYL) were attached to either end of a cleavable enzyme substrate (KTSAVLQSGFRKME). Upon enzymatic cleavage of the substrate, the fluorophore and quencher are separated and emission is restored, producing a signal that is directly correlated to the activity of the enzyme. dmkim@jnu.ac.kr Biotechnology letters 2012 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus peptide substrate peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) KTSAVLQSGFRKME p0c6u8-pro_0000338259 3C-like proteinase nsp5 ORF1a polyprotein 1a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ 3241 3546 (+)-dihydromyricetin (+)-dihydromyricetin (+)-Ampelopsin (+)-Dihydromyricetin (2R,3R)-2,3-dihydro-3,5,7-trihydroxy-2-(3,4,5-trihydroxyphenyl)-4H-1-benzopyran-4-one (2R,3R)-3,3',4',5,5',7-hexahydroxy-2,3-dihydroflavanonol (2R,3R)-3,5,7,3',4',5'-hexahydroxyflavanone (2R,3R)-dihydromyricetin Ampelopsin Ampeloptin Dihydromyricetin (2R,3R)-3,5,7-trihydroxy-2-(3,4,5-trihydroxyphenyl)-2,3-dihydro-4H-chromen-4-one small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) quercetin quercetin 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-1-benzopyran-4-one 3,3',4',5,7-pentahydroxyflavone 3,5,7,3',4'-Pentahydroxyflavone 3,5,7,3',4'-PENTAHYDROXYFLAVONE Quercetin sophoretin xanthaurine 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) puerarin puerarin (1S)-1,5-anhydro-1-[7-hydroxy-3-(4-hydroxyphenyl)-4-oxo-4H-1-benzopyran-8-yl]-D-glucitol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) daidzein daidzein 4',7-dihydroxyisoflavone 7,4'-dihydroxyisoflavone 7-Hydroxy-3-(4-hydroxyphenyl)-4-benzopyrone 7-hydroxy-3-(4-hydroxyphenyl)-4H-1-benzopyran-4-one Daidzein daidzeol isoaurostatin 7-hydroxy-3-(4-hydroxyphenyl)-4H-chromen-4-one small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) (-)-epigallocatechin 3-gallate (-)-epigallocatechin 3-gallate (-)-epigallocatechin-3-O-gallate [(2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-chromen-3-yl] 3,4,5-trihydroxybenzoate EGCG Epigallocatechin 3-gallate (2R,3R)-5,7-dihydroxy-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-chromen-3-yl 3,4,5-trihydroxybenzoate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gallocatechin gallate Gallocatechin gallate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p0c6u8_pro_0000338259-peptide substrate-1 3729534 N/A 3729535 enzyme target enzyme target substrate substrate neutral component neutral component EDANS fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Dabycl quencher dye labelled dye label dye labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3729536 enzyme enzyme neutral component neutral component partially purified partially purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris protein cleavage protein cleavage false false false 3729534 Supplementary Fig 5 (+)_dihydromyricetin-p0c6u8_pro_0000338259-1 3729534 N/A 3729537 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3729535 enzyme target enzyme target substrate substrate neutral component neutral component EDANS fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Dabycl quencher dye labelled dye label dye labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3729536 enzyme enzyme neutral component neutral component partially purified partially purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris protein cleavage protein cleavage false false false 3729534 Table 1, figure 3, number 1 p0c6u8_pro_0000338259-peptide substrate-2 3729534 N/A 3729538 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3729535 enzyme target enzyme target substrate substrate neutral component neutral component EDANS fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Dabycl quencher dye labelled dye label dye labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3729536 enzyme enzyme neutral component neutral component partially purified partially purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris protein cleavage protein cleavage false false false 3729534 Table 1, figure 3, number 2 p0c6u8_pro_0000338259-peptide substrate-3 3729534 N/A 3729539 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3729535 enzyme target enzyme target substrate substrate neutral component neutral component EDANS fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Dabycl quencher dye labelled dye label dye labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3729536 enzyme enzyme neutral component neutral component partially purified partially purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris protein cleavage protein cleavage false false false 3729534 Table 1, figure 3, number 3 p0c6u8_pro_0000338259-peptide substrate-5 3729534 N/A 3729540 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3729535 enzyme target enzyme target substrate substrate neutral component neutral component EDANS fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Dabycl quencher dye labelled dye label dye labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3729536 enzyme enzyme neutral component neutral component partially purified partially purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris protein cleavage protein cleavage false false false 3729534 Table 1, figure 3, number 4 (_)_epigallocatechin 3_gallate-p0c6u8_pro_0000338259-1 3729534 N/A 3729541 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3729535 enzyme target enzyme target substrate substrate neutral component neutral component EDANS fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Dabycl quencher dye labelled dye label dye labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3729536 enzyme enzyme neutral component neutral component partially purified partially purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris protein cleavage protein cleavage false false false 3729534 Table 1, figure 3, number 5 gallocatechin gallate-p0c6u8_pro_0000338259-1 3729534 N/A 3729542 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3729535 enzyme target enzyme target substrate substrate neutral component neutral component EDANS fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Dabycl quencher dye labelled dye label dye labelled n-term range n-terminal range n-term range n-term range n-terminal range n-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3729536 enzyme enzyme neutral component neutral component partially purified partially purified picpa Pichia pastoris (Yeast) Yeast Pichia pastoris protein cleavage protein cleavage false false false 3729534 Table 1, figure 3, number 6