HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html stapleford-2011-1 Hepatitis C virus NS2 coordinates virus particle assembly through physical interactions with the E1-E2 glycoprotein and NS3-NS4A enzyme complexes. human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells pull down pull down western blot western blot Immuno blot Immuno blot Stapleford K.A., Lindenbach B.D. Virus - Publications including interactions involving viral proteins brett.lindenbach@yale.edu J. Virol. (0022-538X) 2011 imex curation Only protein-protein interactions imex curation stapleford-2011-2 Hepatitis C virus NS2 coordinates virus particle assembly through physical interactions with the E1-E2 glycoprotein and NS3-NS4A enzyme complexes. human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells bn-page blue native page bn-page weight by staining molecular weight estimation by staining weight by staining Stapleford K.A., Lindenbach B.D. Virus - Publications including interactions involving viral proteins brett.lindenbach@yale.edu J. Virol. (0022-538X) 2011 imex curation Only protein-protein interactions imex curation q99ib8-pro_0000045599 Serine protease/helicase NS3 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV APITAYAQQTRGLLGAIVVSMTGRDRTEQAGEVQILSTVSQSFLGTTISGVLWTVYHGAGNKTLAGLRGPVTQMYSSAEGDLVGWPSPPGTKSLEPCKCGAVDLYLVTRNADVIPARRRGDKRGALLSPRPISTLKGSSGGPVLCPRGHVVGLFRAAVCSRGVAKSIDFIPVETLDVVTRSPTFSDNSTPPAVPQTYQVGYLHAPTGSGKSTKVPVAYAAQGYKVLVLNPSVAATLGFGAYLSKAHGINPNIRTGVRTVMTGEAITYSTYGKFLADGGCASGAYDIIICDECHAVDATSILGIGTVLDQAETAGVRLTVLATATPPGSVTTPHPDIEEVGLGREGEIPFYGRAIPLSCIKGGRHLIFCHSKKKCDELAAALRGMGLNAVAYYRGLDVSIIPAQGDVVVVATDALMTGYTGDFDSVIDCNVAVTQAVDFSLDPTFTITTQTVPQDAVSRSQRRGRTGRGRQGTYRYVSTGERASGMFDSVVLCECYDAGAAWYDLTPAETTVRLRAYFNTPGLPVCQDHLEFWEAVFTGLTHIDAHFLSQTKQAGENFAYLVAYQATVCARAKAPPPSWDAMWKCLARLKPTLAGPTPLLYRLGPITNEVTLTHPGTKYIATCMQADLEVMT 1031 1661 q99ib8-pro_0000045595 Envelope glycoprotein E1 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV AQVKNTSSSYMVTNDCSNDSITWQLEAAVLHVPGCVPCERVGNTSRCWVPVSPNMAVRQPGALTQGLRTHIDMVVMSATFCSALYVGDLCGGVMLAAQVFIVSPQYHWFVQECNCSIYPGTITGHRMAWDMMMNWSPTATMILAYVMRVPEVIIDIVSGAHWGVMFGLAYFSMQGAWAKVIVILLLAAGVDA 192 383 q99ib8-pro_0000045596 Envelope glycoprotein E2 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV GTTTVGGAVARSTNVIAGVFSHGPQQNIQLINTNGSWHINRTALNCNDSLNTGFLAALFYTNRFNSSGCPGRLSACRNIEAFRIGWGTLQYEDNVTNPEDMRPYCWHYPPKPCGVVPARSVCGPVYCFTPSPVVVGTTDRRGVPTYTWGENETDVFLLNSTRPPQGSWFGCTWMNSTGFTKTCGAPPCRTRADFNASTDLLCPTDCFRKHPDATYIKCGSGPWLTPKCLVHYPYRLWHYPCTVNFTIFKIRMYVGGVEHRLTAACNFTRGDRCDLEDRDRSQLSPLLHSTTEWAILPCTYSDLPALSTGLLHLHQNIVDVQYMYGLSPAITKYVVRWEWVVLLFLLLADARVCACLWMLILLGQAEA 384 750 q99ib8-pro_0000045598 Protease NS2 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV YDAPVHGQIGVGLLILITLFTLTPGYKTLLGQCLWWLCYLLTLGEAMIQEWVPPMQVRGGRDGIAWAVTIFCPGVVFDITKWLLALLGPAYLLRAALTHVPYFVRAHALIRVCALVKQLAGGRYVQVALLALGRWTGTYIYDHLTPMSDWAASGLRDLAVAVEPIIFSPMEKKVIVWGAETAACGDILHGLPVSARLGQEILLGPADGYTSKGWKLL 814 1030 q99ib8_pro-q99ib8_pro-1 1428298 n/a 1428300 unspecified role unspecified role prey prey n/a E1 1428301 unspecified role unspecified role prey prey n/a E2 1428302 unspecified role unspecified role prey prey n/a NS2 1428303 unspecified role unspecified role bait bait biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ap tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4A q99ib8_pro-q99ib8_pr-1 1428298 n/a 1428300 unspecified role unspecified role prey prey n/a NS2 1428303 unspecified role unspecified role bait bait biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a E2 1428302 unspecified role unspecified role prey prey Q99IB8-PRO_0000045596:p.Asp349Trp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 2A, 4A, 5B, 6C Wild type E1 will bind to this complex, E1 with a lys179gln mutation will not. ns2-e2-1 1428298 n/a E2 1428302 unspecified role unspecified role prey prey n/a NS2 1428303 unspecified role unspecified role bait bait ap tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 6C E1-E2 construct (with in-frame deletion of E1-E2 (Jc1 codons 217 to 566)), and the D88 construct (in-frame deletion of Jc1 codons 195 to 807) decresed NS2-E2 interaction ns2-ns3-3 1428298 n/a NS2 1428303 unspecified role unspecified role bait bait biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ap tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1428300 unspecified role unspecified role prey prey physical association physical association false false false 6C D88 construct (in-frame deletion of Jc1 codons 195 to 807) decreased NS2-NS3 interaction e2-multi-3 1428298 n/a NS3 1428300 unspecified role unspecified role prey prey n/a E2 1428302 unspecified role unspecified role bait bait biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NS2 1428303 unspecified role unspecified role prey prey n/a E2 1428302 unspecified role unspecified role prey prey association association false false false 2B e1-e2-10 1428298 n/a E1 1428301 unspecified role unspecified role prey prey Q99IB8-PRO_0000045595:p.Lys179Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false n/a E2 1428302 unspecified role unspecified role bait bait biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q99IB8-PRO_0000045596:p.Asp349Trp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 4C q99ib8-pro-1 1428299 n/a NS2 1428303 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 physical association physical association false false false 3A q99ib8_pr-q99ib8_p-1 1428299 n/a NS3 1428300 unspecified role unspecified role neutral component neutral component n/a E2 1428302 unspecified role unspecified role neutral component neutral component n/a NS2 1428303 unspecified role unspecified role neutral component neutral component physical association physical association false false false 3