UniProt UniProt http://www.uniprot.org ao-2010-3 Importin alpha3 interacts with HIV-1 integrase and contributes to HIV-1 nuclear import and replication. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ao Z., Danappa Jayappa K., Wang B., Zheng Y., Kung S., Rassart E., Depping R., Kohler M., Cohen E.A., Yao X. Virus - Publications including interactions involving viral proteins HIV-1 proteins have been mapped to the UniProt HIV-1 reference strain yao2@cc.umanitoba.ca J. Virol. (0022-538X) 2010 imex curation Only protein-protein interactions ao-2010-1 Importin alpha3 interacts with HIV-1 integrase and contributes to HIV-1 nuclear import and replication. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Ao Z., Danappa Jayappa K., Wang B., Zheng Y., Kung S., Rassart E., Depping R., Kohler M., Cohen E.A., Yao X. Virus - Publications including interactions involving viral proteins HIV-1 proteins have been mapped to the UniProt HIV-1 reference strain yao2@cc.umanitoba.ca J. Virol. (0022-538X) 2010 imex curation Only protein-protein interactions ao-2010-2 Importin alpha3 interacts with HIV-1 integrase and contributes to HIV-1 nuclear import and replication. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ao Z., Danappa Jayappa K., Wang B., Zheng Y., Kung S., Rassart E., Depping R., Kohler M., Cohen E.A., Yao X. Virus - Publications including interactions involving viral proteins HIV-1 proteins have been mapped to the UniProt HIV-1 reference strain yao2@cc.umanitoba.ca J. Virol. (0022-538X) 2010 imex curation Only protein-protein interactions ao-2010-4 Importin alpha3 interacts with HIV-1 integrase and contributes to HIV-1 nuclear import and replication. human-t cells cd 4+ Homo sapiens t-cell_cd4+ t cell cd4+ anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ao Z., Danappa Jayappa K., Wang B., Zheng Y., Kung S., Rassart E., Depping R., Kohler M., Cohen E.A., Yao X. Virus - Publications including interactions involving viral proteins HIV-1 proteins have been mapped to the UniProt HIV-1 reference strain yao2@cc.umanitoba.ca J. Virol. (0022-538X) 2010 imex curation Only protein-protein interactions ima3_human Importin subunit alpha-3 KPNA4 QIP1 Karyopherin subunit alpha-4 Importin alpha Q1 protein protein human Homo sapiens Human MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIGNLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF p04585-pro_0000042447 Integrase gag-pol Pr160Gag-Pol protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTGATVRAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRNPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 1148 1435 vpr_hv1h2 Protein Vpr vpr R ORF protein Viral protein R protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTRQRRARNGASRS gag_pol-kpna4 1574624 n/a 1574628 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1574629 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 5B and 6A and B vpr-kpna4 1574624 n/a 1574630 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1574628 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5B kpna4-gag_pol 1574625 n/a 1574628 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1574629 unspecified role unspecified role prey prey cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 5A kpna4-gag_pol-1 1574626 n/a 1574628 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1574629 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 5A gag_pol-kpna4-1 1574627 n/a 1574628 unspecified role unspecified role prey prey n/a 1574629 unspecified role unspecified role bait bait infection infection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5D