UniProt UniProt http://www.uniprot.org misumi-2010-1 Uncoating of human immunodeficiency virus type 1 requires prolyl isomerase Pin1. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Misumi S., Inoue M., Dochi T., Kishimoto N., Hasegawa N., Takamune N., Shoji S. Virus - Publications including interactions involving viral proteins Purified HIV-1 CA cores have been used. Phosphorylation detected by using a anti-pS17/P17 antibody. Phosphorylation of other Ser-Pro motifs in HIV-1 CA cores has been excluded by MS analysis. Origin of GST-Pin1 according Ref. 21 (PMID 9499405). HIV-1 capsid protein p24 has been mapped to the UniProt HIV-1 virus reference strain. misumi@gpo.kumamoto-u.ac.jp J. Biol. Chem. (0021-9258) 2010 imex curation Only protein-protein interactions p04591-pro_0000038594 Capsid protein p24 gag Pr55Gag protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL 133 363 pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE pin1-gag-1 1574505 n/a 1574506 unspecified role unspecified role prey prey phosphoser-16 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain false n/a 1574507 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 3a and c ALP (alkaline phosphatase) - removes phosphate groups from HIV-1 CA core p24 phosphorylated on Ser-16 Q13526 increases activity of P04591-PRO_0000038594