HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html labiuk-2010-1 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Labiuk SL., Lobanov V., Lawman Z., Snider M., Babiuk LA., van Drunen Littel-van den Hurk S. Virus - Publications including interactions involving viral proteins The 108 strain of BoHV-1 is stated to have been in all experiments but there is no UniProt entry for this strain. The NCBI identifier NP_045368 is stated to be used for US3 protein. For US3 protein the top level TAX_id is 10320 (BHV-1) corresponding to UniProt Q76PF3-which has 100% identity to NP_045368 protein,which is used here. A minor difference from the US3 sequence in NP_045368 was noted, such that in strain 108, bases 319, 324, 325 and 327 are guanine instead of adenine. For VP22 protein the NCBI entry NP_045310 is used in the study. NP_045310 is 100% match to P30022 - Cooper strain, which is confirmed by following up references (from PMID:15650221). sylvia.vandenhurk@usask.ca The Journal of general virology 2010 imex curation Only protein-protein interactions imex curation labiuk-2010-2 bovin-fbt cells bovin fetal bovine testicular cells Bovine fbt cells fetal bovine testicular cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Labiuk SL., Lobanov V., Lawman Z., Snider M., Babiuk LA., van Drunen Littel-van den Hurk S. Virus - Publications including interactions involving viral proteins The 108 strain of BoHV-1 is stated to have been in all experiments but there is no UniProt entry for this strain. The NCBI identifier NP_045368 is stated to be used for US3 protein. For US3 protein the top level TAX_id is 10320 (BHV-1) corresponding to UniProt Q76PF3-which has 100% identity to NP_045368 protein,which is used here. A minor difference from the US3 sequence in NP_045368 was noted, such that in strain 108, bases 319, 324, 325 and 327 are guanine instead of adenine. For VP22 protein the NCBI entry NP_045310 is used in the study. NP_045310 is 100% match to P30022 - Cooper strain, which is confirmed by following up references (from PMID:15650221). sylvia.vandenhurk@usask.ca The Journal of general virology 2010 imex curation Only protein-protein interactions imex curation labiuk-2010-3 bovin-mdbk Bos taurus mdbk Madin-Darby bovine kidney cells confocal microscopy confocal microscopy immunostaining immunostaining Labiuk SL., Lobanov V., Lawman Z., Snider M., Babiuk LA., van Drunen Littel-van den Hurk S. Virus - Publications including interactions involving viral proteins The 108 strain of BoHV-1 is stated to have been in all experiments but there is no UniProt entry for this strain. The NCBI identifier NP_045368 is stated to be used for US3 protein. For US3 protein the top level TAX_id is 10320 (BHV-1) corresponding to UniProt Q76PF3-which has 100% identity to NP_045368 protein,which is used here. A minor difference from the US3 sequence in NP_045368 was noted, such that in strain 108, bases 319, 324, 325 and 327 are guanine instead of adenine. For VP22 protein the NCBI entry NP_045310 is used in the study. NP_045310 is 100% match to P30022 - Cooper strain, which is confirmed by following up references (from PMID:15650221). sylvia.vandenhurk@usask.ca The Journal of general virology 2010 imex curation Only protein-protein interactions imex curation labiuk-2010-4 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Labiuk SL., Lobanov V., Lawman Z., Snider M., Babiuk LA., van Drunen Littel-van den Hurk S. Virus - Publications including interactions involving viral proteins The 108 strain of BoHV-1 is stated to have been in all experiments but there is no UniProt entry for this strain. The NCBI identifier NP_045368 is stated to be used for US3 protein. For US3 protein the top level TAX_id is 10320 (BHV-1) corresponding to UniProt Q76PF3-which has 100% identity to NP_045368 protein,which is used here. A minor difference from the US3 sequence in NP_045368 was noted, such that in strain 108, bases 319, 324, 325 and 327 are guanine instead of adenine. For VP22 protein the NCBI entry NP_045310 is used in the study. NP_045310 is 100% match to P30022 - Cooper strain, which is confirmed by following up references (from PMID:15650221). sylvia.vandenhurk@usask.ca The Journal of general virology 2010 imex curation Only protein-protein interactions imex curation q76pf3_9alph US3 HMKIDIGP_00064 OHMFJBFK_00065 protein protein Bovine herpesvirus 1 Bovine herpesvirus 1 MERAAERLARQRARGLWRSRFACCVAAEPSGEPARPERSRSRCGSARCAAAGSADLYLAVNNEGPEVAPPARTGPPDADGIEGGAAVGNEQGGVAAGNERRAAIGDKKKSASGGENESESESESESESGSESGADDGDWDDDDDAGPAGGVTREEAEGAARALNFRIIRRLTPGSEGRVFEATGPAPAQEHVVLKIGASASTLAEAMLLRTLDHANVVKLKAVLFHGELVCVVLARYREDLHTHLWRINRPLALPAALAVTRAVLRGLAYLHSRRIAHRDVKTENVFLNGPGDVCLGDFGAAHGPVTEPRYYGLAGTLETNSPELLARARYDCRTDVWSAGVVAYEMLAYPRALFDSPAGPQGEDAEASGPPTILGDRDCARQLLRVIRRLAVHAEEFPPSPTDRLTRNFKRHASTRREPHSPYRCLAVLRLPCDADRLLHQMLTFDFRARPTAAELLEHPVFGAASG vp22_bhv1c Tegument protein VP22 UL49 protein protein bhv1c Bovine herpesvirus 1.1 (strain Cooper) BoHV-1 Infectious bovine rhinotracheitis virus MARFHRPSEDEDDYEYSDLWVRENSLYDYESGSDDHVYEELRAATSGPEPSGRRASVRACASAAAVQPAARGRDRAAAAGTTVAAPAAAPARRSSSRASSRPPRAAADPPVLRPATRGSSGGAGAVAVGPPRPRAPPGANAVASGRPLAFSAAPKTPKAPWCGPTHAYNRTIFCEAVALVAAEYARQAAASVWDSDPPKSNERLDRMLKSAAIRILVCEGSGLLAAANDILAARAQRPAARGSTSGGESRLRGERARP a0a0d9r898_chlsb Casein kinase II subunit beta CSNK2B protein protein chlsb chlsb Green monkey Cercopithecus sabaeus MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPSSCSRHPDLPLLPLRRPFCRMHFRLREVYHQQLIPMHGDHHLL us3-us3-1 1882613 N/A 1882617 unspecified role unspecified role prey prey Q76PF3:p.[Lys107Glu;Lys109Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1882617 unspecified role unspecified role bait bait Q76PF3:p.[Lys107Glu;Lys109Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1 us3-ul49-1 1882613 N/A 1882618 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 1882617 unspecified role unspecified role bait bait Q76PF3:p.[Lys107Glu;Lys109Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3B us3-us3-2 1882613 N/A 1882617 unspecified role unspecified role bait bait Q76PF3:p.[Lys107Glu;Lys109Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1882617 unspecified role unspecified role prey prey Q76PF3:p.[Lys107Glu;Lys109Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 1 us3-ul49-2 1882614 N/A 1882618 unspecified role unspecified role prey prey N/A 1882617 unspecified role unspecified role bait bait Q76PF3:p.[Lys107Glu;Lys109Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 3A us3-ul49-3 1882615 N/A 1882618 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1882617 unspecified role unspecified role neutral component neutral component Q76PF3:p.[Lys107Glu;Lys109Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 5B vp22-ck2b-1 1882616 N/A 1882619 unspecified role unspecified role prey prey N/A 1882618 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 6C