HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html szymanski-2009-1 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Szymanski MR., Fiebach AR., Tratschin JD., Gut M., Ramanujam VM., Gottipati K., Patel P., Ye M., Ruggli N., Choi KH. Virus - Publications including interactions involving viral proteins nicolas.ruggli@ivi.admin.ch Journal of molecular biology 2009 imex curation Only protein-protein interactions imex curation p19712-pro_0000038050 N-terminal protease protein protein CSFV Classical swine fever virus (strain Alfort) Hog cholera virus MELNHFELLYKTSKQKPVGVEEPVYDTAGRPLFGNPSEVHPQSTLKLPHDRGRGDIRTTLRDLPRKGDCRSGNHLGPVSGIYIKPGPVYYQDYTGPVYHRAPLEFFDEAQFCEVTKRIGRVTGSDGKLYHIYVCVDGCILLKLAKRGTPRTLKWIRNFTNCPLWVTSC 1 168 irf3_pig Interferon regulatory factor 3 IRF3 protein protein pig Sus scrofa (Pig) Pig MGTQKPRILPWLISQLNQGQLEGVAWLDEGHTRFRIPWKHGLRQDAQQEDFGIFQAWAEASGAYTPGKDKPDLPTWKRNFRSALNRKEALRLAEDHSKDPHDPHKIYEFVTSGVGDFPEPDTSLDLSGRYSTSDTHEDSLDKLLSGMDLASDAGPQSLTLALEQPPQLSLSPSVDAPASCPNLGVRENPLKQLLANDDEWEFQVTVFYRGCQVFQQTVCSPGGLRLVGSEAEDGTLAGQPVRLPDPAASLTDRGVADYVRRVLSCLGGGLALWRAGQWLWAQRLGHCHVYWAMGEELIPDSGHKPDGEVPKDREGGVFDLGPFIEDLIAFIEGSRRSPRYTLWFCMGQSWPQDEPWVKRLVMVKVVPMCLRALVDMARDGGASSLENTVDLHISNSHPLSLTSDQYKACLRDLVEDMDF npro-irf3-3 2846323 N/A 2846324 unspecified role unspecified role unspecified role unspecified role P19712-PRO_0000038050:p.Cys112Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P19712-PRO_0000038050:p.Cys134Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P19712-PRO_0000038050:p.Cys138Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P19712-PRO_0000038050:p.Cys161Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false N/A 2846325 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false 5A