HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html kukihara-2009-2 Human VAP-C negatively regulates hepatitis C virus propagation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kukihara H., Moriishi K., Taguwa S., Tani H., Abe T., Mori Y., Suzuki T., Fukuhara T., Taketomi A., Maehara Y., Matsuura Y. Virus - Publications including interactions involving viral proteins This experiment relates to a negative interaction. matsuura@biken.osaka-u.ac.jp J. Virol. (0022-538X) 2009 imex curation Only protein-protein interactions imex curation o95292-1 Vesicle-associated membrane protein-associated protein B/C VAP-B VAPB UNQ484/PRO983 protein protein human Homo sapiens Human MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL o95292-2 Vesicle-associated membrane protein-associated protein B/C VAP-C VAPB UNQ484/PRO983 protein protein human Homo sapiens Human MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSGRRWTADEEDSAEQQPHFSISPNWEGRRP vapa_human Vesicle-associated membrane protein-associated protein A VAPA VAP33 33 kDa VAMP-associated protein protein protein human Homo sapiens Human MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL vapc-vapb 1500719 n/a 1500720 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ee tag glu tag glu tag glu tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1500721 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false true Fig 1 The interaction does not occur under these experimental conditions. vapc-vapa 1500719 n/a 1500722 unspecified role unspecified role prey prey ee tag glu tag glu tag glu tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1500721 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false true Fig 1 The interaction does not occur under these experimental conditions.