IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ponnusamy-2008-2 in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Ponnusamy R., Moll R., Weimar T., Mesters JR., Hilgenfeld R. Virus - Publications including interactions involving viral proteins Crosslinking agent: gluteraldehyde hilgenfeld@biochem.uni-luebeck.de Journal of molecular biology 2008 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus ponnusamy-2008-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ponnusamy R., Moll R., Weimar T., Mesters JR., Hilgenfeld R. Virus - Publications including interactions involving viral proteins hilgenfeld@biochem.uni-luebeck.de Journal of molecular biology 2008 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus p0c6x1-pro_0000037301 Non-structural protein 9 rep ORF1ab polyprotein 1a-1b protein protein hcov-229e Human coronavirus 229E HCoV-229E NNEIMPGKMKVKATKGEGDGGITSEGNALYNNEGGRAFMYAYVTTKPGMKYVKWEHDSGVVTVELEPPCRFVIDTPTGPQIKYLYFVKNLNNLRRGAVLGYIGATVRLQ 3825 3933 p0c6u8-pro_0000338263 Non-structural protein 9 ORF1a polyprotein 1a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus NNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ 4118 4230 rep-102 3723577 N/A 3723579 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 3.0 physical association physical association false false false Fig. 4 In HCoV-229E Nsp9, the wild-type showed only monomers, dimers, and trimers. rep-rep-89 3723577 N/A 3723579 unspecified role unspecified role neutral component neutral component purified purified P0C6X1-PRO_0000037301:p.Cys69Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3723579 unspecified role unspecified role neutral component neutral component purified purified P0C6X1-PRO_0000037301:p.Cys69Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 4 p0c6u8_pro_0000338263-p0c6u8_pro_0000338263-1 3723577 N/A 3723580 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3723580 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 4 rep-105 3723577 N/A 3723579 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false Fig. 4 In HCoV-229E Nsp9, the wild-type showed only monomers, dimers, and trimers. rep-101 3723578 N/A 3723579 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Table 1 1.75Å Rwork - 0.191 Rfree - 0.225 rep-106 3723578 N/A 3723579 unspecified role unspecified role neutral component neutral component purified purified P0C6X1-PRO_0000037301:p.Cys69Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Table 1 The conditions identified for crystallisation of the wild-type Nsp9 failed to yield crystals of the mutant, so the conditions were modified accordingly