MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint guerra-2008-1 Vaccinia virus E3 protein prevents the antiviral action of ISG15. unknown Unknown anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Guerra S., Cáceres A., Knobeloch KP., Horak I., Esteban M. Virus - Publications including interactions involving viral proteins sguerra@cnb.csic.es PLoS Pathog. (1553-7366) 2008 rapid curation rapid curation guerra-2008-2 Vaccinia virus E3 protein prevents the antiviral action of ISG15. unknown Unknown fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Guerra S., Cáceres A., Knobeloch KP., Horak I., Esteban M. Virus - Publications including interactions involving viral proteins sguerra@cnb.csic.es PLoS Pathog. (1553-7366) 2008 rapid curation rapid curation ub2l6_human Ubiquitin/ISG15-conjugating enzyme E2 L6 UBE2L6 UBCH8 Ubiquitin-protein ligase L6 Ubiquitin carrier protein L6 UbcH8 Retinoic acid-induced gene B protein E2 ubiquitin-conjugating enzyme L6 protein protein human Homo sapiens Human MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS e3_vaccw Protein E3 p25 E3L VACWR059 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MSKIYIDERSNAEIVCEAIKTIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEADKPDADAMADVIIDDVSREKSMREDHKSFDDVIPAKKIIDWKGANPVTVINEYCQITRRDWSFRIESVGPSNSPTFYACVDIDGRVFDKADGKSKRDAKNNAAKLAVDKLLGYVIIRF e3-ube2l6 759717 ub2l6_human 759719 unspecified role unspecified role prey prey ve03_vaccw 759720 unspecified role unspecified role bait bait physical association physical association false false false F5 homomint mint e3-ube2l6-1 759718 ub2l6_human 759719 unspecified role unspecified role neutral component neutral component ve03_vaccw 759720 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false F5 homomint mint