MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint soulat-2008-4 The DEAD-box helicase DDX3X is a critical component of the TANK-binding kinase 1-dependent innate immune response. in vitro In vitro peptide array peptide array predetermined predetermined participant predetermined Soulat D., Bürckstümmer T., Westermayer S., Goncalves A., Bauch A., Stefanovic A., Hantschel O., Bennett KL., Decker T., Superti-Furga G. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2008 2009-02-12 Only protein-protein interactions imex curation soulat-2008-2 The DEAD-box helicase DDX3X is a critical component of the TANK-binding kinase 1-dependent innate immune response. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Soulat D., Bürckstümmer T., Westermayer S., Goncalves A., Bauch A., Stefanovic A., Hantschel O., Bennett KL., Decker T., Superti-Furga G. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2008 2009-02-12 Only protein-protein interactions imex curation soulat-2008-3 The DEAD-box helicase DDX3X is a critical component of the TANK-binding kinase 1-dependent innate immune response. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Soulat D., Bürckstümmer T., Westermayer S., Goncalves A., Bauch A., Stefanovic A., Hantschel O., Bennett KL., Decker T., Superti-Furga G. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2008 2009-02-12 Only protein-protein interactions imex curation soulat-2008-1 The DEAD-box helicase DDX3X is a critical component of the TANK-binding kinase 1-dependent innate immune response. mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Soulat D., Bürckstümmer T., Westermayer S., Goncalves A., Bauch A., Stefanovic A., Hantschel O., Bennett KL., Decker T., Superti-Furga G. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2008 2009-02-12 Only protein-protein interactions imex curation ddx3x_mouse ATP-dependent RNA helicase DDX3X DEAD box protein 3, X-chromosomal DEAD box RNA helicase DEAD3 Embryonic RNA helicase D1Pas1-related sequence 2 Ddx3x D1Pas1-rs2 Ddx3 Dead3 Erh protein protein mouse Mus musculus Mouse MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRGDSRGKSSFFGDRGSGSRGRFDDRGRGDYDGIGGRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAFEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGGSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN tbk1_human Serine/threonine-protein kinase TBK1 TBK1 NAK TANK-binding kinase 1 T2K NF-kappa-B-activating kinase protein protein human Homo sapiens Human MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL ddx3x_human ATP-dependent RNA helicase DDX3X DDX3X DBX DDX3 DEAD box protein 3, X-chromosomal Helicase-like protein 2 DEAD box, X isoform CAP-Rf protein protein human Homo sapiens Human MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN irf3_human Interferon regulatory factor 3 IRF3 protein protein human Homo sapiens Human MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES tbk1_mouse Serine/threonine-protein kinase TBK1 TANK-binding kinase 1 T2K Tbk1 protein protein mouse Mus musculus Mouse MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPLSCSLSQGLQALLTPVLANILEADQEKCWGFDQFFAETSDVLHRMVIHVFSLQHMTAHKIYIHSYNTAAVFHELVYKQTKIVSSNQELIYEGRRLVLELGRLAQHFPKTTEENPIFVTSREQLNTVGLRYEKISLPKIHPRYDLDGDASMAKAVTGVVCYACRTASTLLLYQELMRKGVRWLVELVKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKVNLEAAELGEISDIHTKLLRLSSSQGTIESSLQDISSRLSPGGLLADTWAHQEGTHPRDRNVEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMSHFSEECVRKYEAFKDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQDYTNELQETLPQKMLAASGGVKHAMAPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL tank_mouse TRAF family member-associated NF-kappa-B activator TRAF-interacting protein Tank Itraf protein protein mouse Mus musculus Mouse MSLKRHSLRRNACHLETRAGIPTILYSDATGQRGMDKNIGEQLNRAYEAFRQACMDRDSAVRELQQKQTENYEQRIREQQEQLSFQQNLIDRLKSQLLLVDSSRDNSYGYVPLLEDSDRRKNNLTLDEPHDKVKLGTLRDKQSKVRRQEVSSGKESAKGLNIPLHHERDNIEKTFWDLKEEFHRICLLAKAQKDHLSKLNIPDIATDTQCSVPIQCTDKTEKQEALFKPQAKDDINRGMSCVTAVTPRGLGRDEEDTSFESLSKFNVKFPPMDNDSIFLHSTPEAPSILAPATPETVCQDRFNMEVRDNPGNFVKTEETLFEIQGIDPITSAIQNLKTTDKTNPSNLRATCLPAGDHNVFYVNTFPLQDPPDAPFPSLDSPGKAVRGPQQPFWKPFLNQDTDLVVPSDSDSELLKPLVCEFCQELFPPSITSRGDFLRHLNTHFNGET tbkb1_mouse TANK-binding kinase 1-binding protein 1 Tbkbp1 Sintbad Similar to NAP1 TBK1 adapter protein protein mouse Mus musculus Mouse MESMFEDDISILTQEALGPSEVWLDGPGDPSLGGDMCSASHFALITAYGDIKERLGGLERENATLRRRLKVYEIKYPLITDFGEEHGFPLYELKDGSLLEVEKVSLQQRLNQFQHELQKSKEQEEQLGEMIQAYEKLCVEKSDLETELGEMRALVETHLRQICGLEKQLQQQQGLRDAAFSSLSPPAVPASACPDLDLHYLALRGGPALGHAGWPGPTSVSVSELERRRLEEALEAAQGEARGAQLREEQLQAECERLQGELKQLQETRAQDLASNQSECDMAWVKRVGDDQVNLALAYTELTEELGRLRELSSLQGRILRTLLQEQARNAGQRHSPLSQRHSPAPACPSPSPPARPPPCAPCQSPAAQRRSPVPPCPSPQQRRSPASPSCPSPVPQRRSPVPPSCQSPSPQRRSPVPPSCPAPQPRPPPPPGERTLAERVYAKPPSHHAKAGFQGRRSYSELAEGAAYAGASPAWLQAEAATLPKPRAYGGELYGRPLSPRRAFEGIRLRFEKQPSEEEEWAMPASPPSPEAGTIRCASFCAGFPIPESPAATAYAHAEHAQSWPSINLLMETVGSDIRSCPLCQLGFPVGYPDDALIKHIDSHLENSKI Adapter protein which constitutively binds TBK1 and IKBKE and may play a role in antiviral innate immunity. Essential for the efficient induction of IRF-dependent transcription following infection with Sendai virus mint ddx3x-tbk1-1 795970 ddx3x_mouse Ddx3x 795974 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false resulting-ptm fllpilsqiyadg FLLPILSQIYADG polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false tbk1_human Tbk1 795975 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation false false false F7a homomint mint ddx3x-tbk1-2 795970 ddx3x_mouse Ddx3x 795974 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false resulting-ptm fllpilsqiyadg FLLPILSQIYADG polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false tbk1_human Tbk1 795975 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation false false false F7a homomint mint ddx3x-tbk1-3 795970 ddx3x_mouse Ddx3x 795974 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false resulting-ptm fllpilsqiyadg FLLPILSQIYADG polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false tbk1_human Tbk1 795975 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation false false false F7a homomint mint ddx3x-tbk1-4 795970 ddx3x_mouse Ddx3x 795974 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified fllpilsqiyadg FLLPILSQIYADG polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false resulting-ptm tbk1_human Tbk1 795975 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation false false false F7a homomint mint ddx3x-tbk1-5 795970 tbk1_human Tbk1 795975 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified ddx3x_mouse Ddx3x 795974 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified fllpilsqiyadg FLLPILSQIYADG polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false resulting-ptm phosphorylation phosphorylation reaction phosphorylation false false false F7a homomint mint ddx3x-tbk1-6 795970 ddx3x_mouse Ddx3x 795974 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified fllpilsqiyadg FLLPILSQIYADG polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false tbk1_human Tbk1 795975 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation false false false F7a homomint mint ddx3x-tbk1-7 795970 ddx3x_mouse Ddx3x 795974 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified fllpilsqiyadg FLLPILSQIYADG polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false tbk1_human Tbk1 795975 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation false false false F7a homomint mint ddx3x-tbk1-8 795970 tbk1_human Tbk1 795975 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified ddx3x_mouse Ddx3x 795974 peptide synthesis peptide synthesis enzyme target enzyme target substrate substrate neutral component neutral component purified purified fllpilsqiyadg FLLPILSQIYADG polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false phosphorylation phosphorylation reaction phosphorylation false false false F7a homomint mint ddx3x-tbk1 795971 ddx3x_human Ddx3x 795976 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tbk1_human Tbk1 795975 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation false false false F6C homomint mint irf3-tbk1-1 795971 irf3_human IRF3 795977 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tbk1_human Tbk1 795975 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation false false false F6C homomint mint tbk1-tank-4 795972 tbk1_mouse Tbk1 795978 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q9WUN2:p.Ser172Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tank_mouse Tank 795979 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false SF1A SF1B homomint mint tbk1-tbkbp1-1 795972 tbkb1_mouse Tbkbp1 795980 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tbk1_mouse Tbk1 795978 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false SF1B homomint mint tbk1-ddx3x 795973 tbkb1_mouse Tbkbp1 795980 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ddx3x_mouse Ddx3x 795974 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tank_mouse Tank 795979 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tbk1_mouse Tbk1 795978 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false F1B homomint mint