UniProt UniProt http://www.uniprot.org chatel_chaix-2007-1 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret tag fluorescence tag visualisation by fluorescence tag fluorescence Chatel-Chaix L., Boulay K., Mouland AJ., Desgroseillers L. Virus - Publications including interactions involving viral proteins luc.desgroseillers@umontreal.ca Retrovirology 2007 IMEx mimix curation HIV-1 gag has been mapped to the UniProt reference strain. Origin of Stau1 according Chatel-Chaix et al 2007, pmid 17428849. Only protein-protein interactions imex curation imex curation chatel_chaix-2007-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chatel-Chaix L., Boulay K., Mouland AJ., Desgroseillers L. Virus - Publications including interactions involving viral proteins luc.desgroseillers@umontreal.ca Retrovirology 2007 IMEx mimix curation HIV-1 gag has been mapped to the UniProt reference strain. Origin of Stau1 according Chatel-Chaix et al 2007, pmid 17428849. Only protein-protein interactions imex curation imex curation chatel_chaix-2007-3 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chatel-Chaix L., Boulay K., Mouland AJ., Desgroseillers L. Virus - Publications including interactions involving viral proteins luc.desgroseillers@umontreal.ca Retrovirology 2007 IMEx mimix curation HIV-1 gag has been mapped to the UniProt reference strain. Origin of Stau1 according Chatel-Chaix et al 2007, pmid 17428849. Only protein-protein interactions imex curation imex curation gag_hv1h2 Gag polyprotein gag Pr55Gag protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPEESFRSGVETTTPPQKQEPIDKELYPLTSLRSLFGNDPSSQ o95793-2 Double-stranded RNA-binding protein Staufen homolog 1 STAU1 STAU protein protein human Homo sapiens Human MKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEENLNKSEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPEYGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFKVPQAQPTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPMVPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC stau1-gag-1 1788033 N/A 1788036 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept nucl transfection nucleic acid transfection nucl transfection NC+P_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P04591:p.Cys392Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P04591:p.Cys426Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P04591:p.Arg384_Lys388delinsSerAsnGlnSerSer mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P04591:p.[Cys392Ser;Cys426Ser] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 1788037 unspecified role unspecified role fluorescence donor fluorescence donor nucl transfection nucleic acid transfection nucl transfection c_terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false 2A and B gag-1 1788033 N/A 1788036 unspecified role unspecified role fluorescence donor fluorescence donor nucl transfection nucleic acid transfection nucl transfection c-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1788036 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept nucl transfection nucleic acid transfection nucl transfection c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P04591:p.[Cys392Ser;Cys426Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false proximity proximity close-contact colocalization neighbourhood interaction false false false 3, 4 Stau1 UniProt AC O95793-2 enhances gag multimerization; Stau1 N-terminus 1-88 is required for the effect; Stau1 full length phe135ala construct has no effect gag-stau1-2 1788033 N/A 1788036 unspecified role unspecified role fluorescence donor fluorescence donor nucl transfection nucleic acid transfection nucl transfection c-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range false cap2ncp1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range false N/A 1788037 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept nucl transfection nucleic acid transfection nucl transfection c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false dnt88 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O95793-2:p.Phe135Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false dsrna-bd_dom required to bind necessary binding region required to bind range range range range false proximity proximity close-contact colocalization neighbourhood interaction false false false 5 gag-stau1-1 1788034 N/A 1788036 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P04591:p.[Cys392Ser;Cys426Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 1788037 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 2D gag-stau1-3 1788035 N/A 1788036 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection N/A 1788037 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 5E