MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint hamilton-2008-1 Cystatin F is a cathepsin C-directed protease inhibitor regulated by proteolysis. human-u937_pr9 Homo sapiens U937-PR9 lymphoma cells expressing zinc-inducible PML-RAR alpha u937_pr9 U937-PR9 hematopoietic precursor cells expressing zinc-inducible PML-RAR alpha U937-PR9 cells, which are hematopoietic precursor cells carrying the PML-RARa coding sequence under the control of a zinc-inducible promoter. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Hamilton G., Colbert JD., Schuettelkopf AW., Watts C. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation hamilton-2008-2 Cystatin F is a cathepsin C-directed protease inhibitor regulated by proteolysis. mouse-bmm mouse bone marrow derived macrophages bmm bone marrow derived macrophages Bone marrow derived macrophages (BMM) were generated in vitro from precursor cells harvested from the femurs of C57BL/6 mice (7�8 weeks) by proliferation and differentiation in the presence of L-cell conditioned medium. as a source of CSF-1 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Hamilton G., Colbert JD., Schuettelkopf AW., Watts C. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation catc_human Dipeptidyl peptidase 1 Dipeptidyl peptidase I Cathepsin C Cathepsin J Dipeptidyl transferase CTSC CPPI protein protein human Homo sapiens Human MGAGPSLLLAALLLLLSGDGAVRCDTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKKVGTASENVYVNIAHLKNSQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTSWDWRNVHGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALMKLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL cytf_human Cystatin-F CST7 Cystatin-7 Cystatin-like metastasis-associated protein Leukocystatin protein protein human Homo sapiens Human MRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH catc_mouse Dipeptidyl peptidase 1 Dipeptidyl peptidase I Ctsc Cathepsin C Cathepsin J Dipeptidyl transferase protein protein mouse Mus musculus Mouse MGPWTHSLRAVLLLVLLGVCTVRSDTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAFFKYEVRGHTAISYCHETMTGWVHDVLGRNWACFVGKKVESHIEKVNMNAAHLGGLQERYSERLYTHNHNFVKAINTVQKSWTATAYKEYEKMSLRDLIRRSGHSQRIPRPKPAPMTDEIQQQILNLPESWDWRNVQGVNYVSPVRNQESCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSPYAQGCDGGFPYLIAGKYAQDFGVVEESCFPYTAKDSPCKPRENCLRYYSSDYYYVGGFYGGCNEALMKLELVKHGPMAVAFEVHDDFLHYHSGIYHHTGLSDPFNPFELTNHAVLLVGYGRDPVTGIEYWIIKNSWGSNWGESGYFRIRRGTDECAIESIAVAAIPIPKL mint Thiol protease. Has dipeptidylpeptidase activity. Can act as both an exopeptidase and endopeptidase. Can degrade glucagon. Plays a role in the generation of cytotoxic lymphocyte effector function cytf_mouse Cystatin-F Cst7 Leukocystatin Cystatin-7 Cystatin-like metastasis-associated protein protein protein mouse Mus musculus Mouse MWLAILLALCCLTSDTHGARPPDFCSKDLISSVKPGFPKTIETNNPGVLKAARHSVEKFNNCTNDIFLFKESHVSKALVQVVKGLKYMLEVKIGRTTCRKTMHHQLDNCDFQTNPALKRTLYCYSEVWVIPWLHSFEVPVLLCQ Inhibits papain and cathepsin L but with affinities lower than other cystatins. May play a role in immune regulation through inhibition of a unique target in the hematopoietic system mint cst7-ctsc 725660 catc_human cathepsin c light chain 725662 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cytf_human Cystatin-F 725663 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f1a Interaction occurs also in YT cells. homomint mint cst7-ctsc-1 725660 cytf_human Cystatin-F 725663 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level catc_human cathepsin c heavy chain 725662 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f1a Interaction occurs also in YT cells. homomint mint cst7-ctsc-2 725661 catc_mouse cathepsin c 725664 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell cytf_mouse Cystatin-F 725665 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f5b Only Cystatin-F lacking the N-terminus shows colocalization with Cathepsin C. homomint mint