DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kumar-2007-3 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Kumar P., Gunalan V., Liu B., Chow VT., Druce J., Birch C., Catton M., Fielding BC., Tan YJ., Lal SK. Virus - Publications including interactions involving viral proteins suhonglin@nchu.edu.tw Virology 2007 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus kumar-2007-2 yeast Saccharomyces cerevisiae Baker's yeast two hybrid array two hybrid array experimental particp experimental participant identification experimental particp Kumar P., Gunalan V., Liu B., Chow VT., Druce J., Birch C., Catton M., Fielding BC., Tan YJ., Lal SK. Virus - Publications including interactions involving viral proteins suhonglin@nchu.edu.tw Virology 2007 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus kumar-2007-4 chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip experimental particp experimental participant identification experimental particp Kumar P., Gunalan V., Liu B., Chow VT., Druce J., Birch C., Catton M., Fielding BC., Tan YJ., Lal SK. Virus - Publications including interactions involving viral proteins suhonglin@nchu.edu.tw Virology 2007 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus kumar-2007-5 chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] confocal microscopy confocal microscopy experimental particp experimental participant identification experimental particp Kumar P., Gunalan V., Liu B., Chow VT., Druce J., Birch C., Catton M., Fielding BC., Tan YJ., Lal SK. Virus - Publications including interactions involving viral proteins suhonglin@nchu.edu.tw Virology 2007 Only protein-protein interactions imex curation imex curation Coronavirus - Interactions investigated in the context of Coronavirus q19qw5_sars Accessory protein 6 ORF6 sars6 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPLTKKNYSELDDEEPMELDYP p0c6x7-pro_0000037315 Non-structural protein 8 ORF1ab polyprotein 1a-1b rep protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus AIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQ 3920 4117 orf6-rep-1 3716163 N/A 3716167 autoradiography autoradiography unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false S35 S35 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3716168 autoradiography autoradiography unspecified role unspecified role prey prey over-expressed over expressed level over-expressed His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false S35 S35 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig 3b rep-orf6-1 3716163 N/A 3716167 autoradiography autoradiography predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false S35 S35 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 3716168 autoradiography autoradiography predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false S35 S35 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Fig 3b orf6-1 3716164 N/A 3716167 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed yeast Saccharomyces cerevisiae Baker's yeast N/A 3716168 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed yeast Saccharomyces cerevisiae Baker's yeast physical association physical association false false false Fig 2 orf6-rep-2 3716165 N/A 3716167 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] N/A 3716168 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] physical association physical association false false false Fig 5 orf6-rep-3 3716166 N/A 3716167 immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] N/A 3716168 immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell African green monkey kidney epithelial cells epithelium Epithelium [epithelial cells] colocalization colocalization false false false Fig 6