MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint bell-2007-1 The E1circumflexE4 protein of human papillomavirus interacts with the serine-arginine-specific protein kinase SRPK1. unknown Unknown pull down pull down predetermined predetermined participant predetermined Bell I., Martin A., Roberts S. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2007 rapid curation rapid curation bell-2007-2 The E1circumflexE4 protein of human papillomavirus interacts with the serine-arginine-specific protein kinase SRPK1. unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Bell I., Martin A., Roberts S. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2007 rapid curation rapid curation bell-2007-3 The E1circumflexE4 protein of human papillomavirus interacts with the serine-arginine-specific protein kinase SRPK1. unknown Unknown fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Bell I., Martin A., Roberts S. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2007 rapid curation rapid curation bell-2007-4 The E1circumflexE4 protein of human papillomavirus interacts with the serine-arginine-specific protein kinase SRPK1. unknown Unknown protein kinase assay protein kinase assay predetermined predetermined participant predetermined Bell I., Martin A., Roberts S. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2007 rapid curation rapid curation a7y3z3_hpv16 protein protein hpv16 Human papillomavirus type 16 MADPAAATKYPLLKLLGSTWPTTPPRPIPKPSPWAPKKHRRLSSDQDQSQTPETPATPLSCCTETQWTVLQSSLHLTAHTKDGLTVIVTLHP mint srpk1_human SRSF protein kinase 1 Serine/arginine-rich protein-specific kinase 1 SFRS protein kinase 1 SRPK1 protein protein human Homo sapiens Human MERKVLALQARKKRTKAKKDKAQRKSETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQRSGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAELLEKRMQEIEEMEKESGPGQKRPNKQEESESPVERPLKENPPNKMTQEKLEESSTIGQDQTLMERDTEGGAAEINCNGVIEVINYTQNSNNETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQETDSCTPITSEVSDTMVCQSSSTVGQSFSEQHISQLQESIRAEIPCEDEQEQEHNGPLDNKGKSTAGNFLVNPLEPKNAEKLKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWGLFEVLVEKYEWSQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWLNS a7y3z3-srpk1 758735 a7y3z3_hpv16 758739 unspecified role unspecified role bait bait srpk1_human 758740 unspecified role unspecified role prey prey physical association physical association false false false F1 F3 homomint mint srpk1-a7y3z3 758736 a7y3z3_hpv16 758739 unspecified role unspecified role prey prey srpk1_human 758740 unspecified role unspecified role bait bait physical association physical association false false false F2 F4 homomint mint srpk1-a7y3z3-1 758737 a7y3z3_hpv16 758739 unspecified role unspecified role prey prey srpk1_human 758740 unspecified role unspecified role bait bait physical association physical association false false false F5 homomint mint srpk1-a7y3z3-2 758738 a7y3z3_hpv16 758739 unspecified role unspecified role prey prey srpk1_human 758740 unspecified role unspecified role bait bait phosphorylation phosphorylation reaction phosphorylation false false false F6 F7 homomint mint