MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint zhou-2007a-2 Interaction of rice dwarf virus outer capsid P8 protein with rice glycolate oxidase mediates relocalization of P8. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Zhou F., Wu G., Deng W., Pu Y., Wei C., Li Y. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation zhou-2007a-1 Interaction of rice dwarf virus outer capsid P8 protein with rice glycolate oxidase mediates relocalization of P8. yeast Saccharomyces cerevisiae Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Zhou F., Wu G., Deng W., Pu Y., Wei C., Li Y. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation zhou-2007a-3 Interaction of rice dwarf virus outer capsid P8 protein with rice glycolate oxidase mediates relocalization of P8. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection imaging technique imaging technique microscopy predetermined predetermined participant predetermined Zhou F., Wu G., Deng W., Pu Y., Wei C., Li Y. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation p8_rdva Outer capsid protein P8 Structural protein P8 protein protein rdva Rice dwarf virus (isolate Akita) MSRQMWLDTSALLEAISEYVVRCNGDTFSGLTTGDFNALSNMFTQLSVSSAGYVSDPRVPLQTMSNMFVSFITSTDRCGYMLRKTWFNSDTKPTVSDDFITTYIRPRLQVPMSDTVRQLNNLSLQPSAKPKLYERQNAIMKGLDIPYSEPIEPCKLFRSVAGQTGNIPMMGILATPPAAQQQPFFVAERRRILFGIRSNAAIPAGAYQFVVPAWASVLSVTGAYVYFTNSFFGTTIAGVTATATAADAATTFTVPTDANNLPVQTDSRLSFSLGGGNINLELGVAKTGFCVAIEGEFTILANRSQAYYTLNSITQTPTSIDDFDVSDFLTTFLSQLRACGQYEIFSDAMDQLTNSLITNYMDPPALPAGLAFTSPWFRFSERARTILALQNVDLNIRKLIVRHLWVITSLIAVFGRYYRPN mint o22544_orysa (S)-2-hydroxy-acid oxidase GOX protein protein orysa Oryza sativa (Rice) Rice MGEITNVMEYQAIANQNLPKMIYDYYSSGAEDDWTLKENREAFSAILFRPRILIDVSKIDMSATVLGFKISMPIMIAPSAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGNPFLHLYLCKDRNVVEHLVKKTKRAGFKAIALTVDAPRLGRRETDIKNRFVLPPYLTLKKFEGLDLPEMDKSNDSGLASYVAGQIDRALTWKDVKWLQSITSLPILVKGVITAEDAKLAVHSGAAGIIVSNHGARQLDYVPATISALEEVVTAAAGRIPVYLDGGVRRGTDVFKALALGAAGVFIGKPVVFALAAEGKAGVRNLLRMMREEFELTMAFSGCTSLADITRAHIYTDAERLARPFPRL mint p8-gox-1 576866 vp8_rdva p8 576869 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false o22544_orysa Gox 576870 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3 F5 mint gox-p8 576866 o22544_orysa Gox 576870 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false vp8_rdva p8 576869 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3 F5 mint p8-gox 576867 vp8_rdva p8 576869 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false o22544_orysa Gox 576870 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1 mint gox-p8-1 576868 vp8_rdva p8 576869 experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false o22544_orysa Gox 576870 experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false F4B mint