UniProt UniProt http://www.uniprot.org busschots-2007-1 Identification of the LEDGF/p75 binding site in HIV-1 integrase. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Busschots K., Voet A., De Maeyer M., Rain J.C., Emiliani S., Benarous R., Desender L., Debyser Z., Christ F. Virus - Publications including interactions involving viral proteins HIV-1 vector pNL4-3 is an artificial sequence. According to ref 14 (pubmed 12796494) HIV-1 clone pNL4-3 has been used with NCBI AC M19921 which was mapped to UniProt zeger.debyser@med.kuleuven.be J. Mol. Biol. (0022-2836) 2007 Only protein-protein interactions imex curation busschots-2007-2 Identification of the LEDGF/p75 binding site in HIV-1 integrase. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Busschots K., Voet A., De Maeyer M., Rain J.C., Emiliani S., Benarous R., Desender L., Debyser Z., Christ F. Virus - Publications including interactions involving viral proteins HIV-1 vector pNL4-3 is an artificial sequence. According to ref 14 (pubmed 12796494) HIV-1 clone pNL4-3 has been used with NCBI AC M19921 which was mapped to UniProt zeger.debyser@med.kuleuven.be J. Mol. Biol. (0022-2836) 2007 Only protein-protein interactions imex curation o75475-1 PC4 and SFRS1-interacting protein p75 PSIP1 PSIP1 DFS70 LEDGF PSIP2 CLL-associated antigen KW-7 Dense fine speckles 70 kDa protein Lens epithelium-derived growth factor Transcriptional coactivator p75/p52 protein protein human Homo sapiens Human MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNGGSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN Less active than isoform 2 as transcriptional coactivator, but more abundant in cells. p12497-pro_0000042402 Integrase gag-pol Pr160Gag-Pol protein protein hv1n5 Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1) HIV-1 FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 1148 1435 gag_pol-psip1-24 1778742 n/a 1778744 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1778745 unspecified role unspecified role bait bait purified purified P12497-PRO_0000042402:p.Trp132Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P12497-PRO_0000042402:p.Ile161Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Arg166Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Asp167Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Gln168Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Glu170Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Trp131Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Gln164Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Val165Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2a and Table 1 gag_pol-psip1-25 1778742 n/a 1778744 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1778745 unspecified role unspecified role bait bait purified purified P12497-PRO_0000042402:p.Asp64Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Gln168Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Arg166Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Trp132Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Trp131Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P12497-PRO_0000042402:p.Glu170Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Val165Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Ile161Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2b and Table 1 gag_pol-psip1-26 1778743 n/a 1778744 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) n/a 1778745 unspecified role unspecified role bait bait purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P12497-PRO_0000042402:p.Val165Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Gln168Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Arg166Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Trp131Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P12497-PRO_0000042402:p.Trp132Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2b