MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint aoyagi-2007-2 Vaccinia virus N1L protein resembles a B cell lymphoma-2 (Bcl-2) family protein. unknown Unknown fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Aoyagi M., Zhai D., Jin C., Aleshin AE., Stec B., Reed JC., Liddington RC. Virus - Publications including interactions involving viral proteins Protein Sci. (0961-8368) 2007 rapid curation rapid curation aoyagi-2007-1 Vaccinia virus N1L protein resembles a B cell lymphoma-2 (Bcl-2) family protein. unknown Unknown x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Aoyagi M., Zhai D., Jin C., Aleshin AE., Stec B., Reed JC., Liddington RC. Virus - Publications including interactions involving viral proteins Protein Sci. (0961-8368) 2007 rapid curation rapid curation n1_vaccw Protein N1 VACWR028 N1L protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MRTLLIRYILWRNDNDQTYYNDNFKKLMLLDELVDDGDVCTLIKNMRMTLSDGPLLDRLNQPVNNIEDAKRMIAISAKVARDIGERSEIRWEESFTILFRMIETYFDDLMIDLYGEK mint bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH bax-n1 759529 vn01_vaccw 759531 unspecified role unspecified role neutral component neutral component bax_human 759532 unspecified role unspecified role neutral component neutral component physical association physical association false false false F3c,d homomint mint bid-n1 759529 vn01_vaccw 759531 unspecified role unspecified role neutral component neutral component bid_human 759533 unspecified role unspecified role neutral component neutral component physical association physical association false false false F3c,d homomint mint bcl2l11-n1 759529 vn01_vaccw 759531 unspecified role unspecified role neutral component neutral component b2l11_human 759534 unspecified role unspecified role neutral component neutral component physical association physical association false false false F3c,d homomint mint n1-n1 759530 vn01_vaccw 759531 unspecified role unspecified role neutral component neutral component vn01_vaccw 759531 unspecified role unspecified role neutral component neutral component physical association physical association false false false F2 homomint mint