MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint brimer-2007-2 Association of E6AP (UBE3A) with human papillomavirus type 11 E6 protein. unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Brimer N., Lyons C., Vande Pol SB. Virus - Publications including interactions involving viral proteins Virology (0042-6822) 2007 rapid curation rapid curation brimer-2007-3 Association of E6AP (UBE3A) with human papillomavirus type 11 E6 protein. unknown Unknown ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Brimer N., Lyons C., Vande Pol SB. Virus - Publications including interactions involving viral proteins Virology (0042-6822) 2007 rapid curation rapid curation brimer-2007-1 Association of E6AP (UBE3A) with human papillomavirus type 11 E6 protein. unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Brimer N., Lyons C., Vande Pol SB. Virus - Publications including interactions involving viral proteins Virology (0042-6822) 2007 rapid curation rapid curation ube3a_human Ubiquitin-protein ligase E3A E6AP ubiquitin-protein ligase Oncogenic protein-associated protein E6-AP Human papillomavirus E6-associated protein Renal carcinoma antigen NY-REN-54 UBE3A E6AP EPVE6AP HPVE6A HECT-type ubiquitin transferase E3A protein protein human Homo sapiens Human MEKLHQCYWKSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIRRVYTRLLSNEKIETAFLNALVYLSPNVECDLTYHNVYSRDPNYLNLFIIVMENRNLHSPEYLEMALPLFCKAMSKLPLAAQGKLIRLWSKYNADQIRRMMETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETENKFSFMTCPFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML ve6_hpv11 Protein E6 E6 protein protein hpv11 Human papillomavirus type 11 MESKDASTSATSIDQLCKTFNLSLHTLQIQCVFCRNALTTAEIYAYAYKNLKVVWRDNFPFAACACCLELQGKINQYRHFNYAAYAPTVEEETNEDILKVLIRCYLCHKPLCEIEKLKHILGKARFIKLNNQWKGRCLHCWTTCMEDLLP q77e16_hpv16 Protein E6 E6 protein protein hpv16 Human papillomavirus type 16 MFQDPQERPIKLPDLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRYYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL mint e6-ube3a-1 758595 ube3a_human 758598 unspecified role unspecified role prey prey ve6_hpv11 758599 unspecified role unspecified role bait bait physical association physical association false false false F2 homomint mint e6-ube3a-2 758595 q77e16_hpv16 758600 unspecified role unspecified role bait bait ube3a_human 758598 unspecified role unspecified role prey prey physical association physical association false false false F2 homomint mint e6-ube3a-3 758596 ve6_hpv11 758599 unspecified role unspecified role neutral component neutral component ube3a_human 758598 unspecified role unspecified role neutral component neutral component physical association physical association false false false F3 homomint mint e6-ube3a-4 758596 q77e16_hpv16 758600 unspecified role unspecified role neutral component neutral component ube3a_human 758598 unspecified role unspecified role neutral component neutral component physical association physical association false false false F3 homomint mint e6-ube3a 758597 ube3a_human 758598 unspecified role unspecified role prey prey ve6_hpv11 758599 unspecified role unspecified role bait bait physical association physical association false false false F1 homomint mint