HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html tsao-2006-4 Interaction of hepatitis C virus F protein with prefoldin 2 perturbs tubulin cytoskeleton organization. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tsao M.L., Chao C.H., Yeh C.T. Virus - Publications including interactions involving viral proteins chauting@adm.cgmh.org.tw Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation They cloned PF2L from liver mRNA sold by invitrogen. Invitrogen catalog only offer human liver mRNA. Only protein-protein interactions tsao-2006-2 Interaction of hepatitis C virus F protein with prefoldin 2 perturbs tubulin cytoskeleton organization. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Tsao M.L., Chao C.H., Yeh C.T. Virus - Publications including interactions involving viral proteins chauting@adm.cgmh.org.tw Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation They cloned PF2L from liver mRNA sold by invitrogen. Invitrogen catalog only offer human liver mRNA. Only protein-protein interactions tsao-2006-3 Interaction of hepatitis C virus F protein with prefoldin 2 perturbs tubulin cytoskeleton organization. chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed confocal microscopy confocal microscopy immunostaining immunostaining Tsao M.L., Chao C.H., Yeh C.T. Virus - Publications including interactions involving viral proteins They cloned PF2L from liver mRNA sold by invitrogen. Invitrogen catalog only offer human liver mRNA. chauting@adm.cgmh.org.tw Biochem. Biophys. Res. Commun. (0006-291X) 2006 Only protein-protein interactions imex curation tsao-2006-1 Interaction of hepatitis C virus F protein with prefoldin 2 perturbs tubulin cytoskeleton organization. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Tsao M.L., Chao C.H., Yeh C.T. Virus - Publications including interactions involving viral proteins chauting@adm.cgmh.org.tw Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation They cloned PF2L from liver mRNA sold by invitrogen. Invitrogen catalog only offer human liver mRNA. Only protein-protein interactions pfd1_human Prefoldin subunit 1 PFDN1 PFD1 protein protein human Homo sapiens Human MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ pfd2_human Prefoldin subunit 2 HSPC231 PFDN2 PFD2 protein protein human Homo sapiens Human MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS f_hcv77 F protein Alternate reading frame protein/F-protein Frameshifted protein p16 p17 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) MSTNPKPQRKKPNVTPTVAHRTSSSRVAVRSLVEFTCCRAGALDWVCARRGRLPSGRNLEVDVSLSPRHVGPRAGPGLSPGTLGPSMAMRVAGGRDGSCLPVALGLAGAPQTPGVGRAIWVRSSIPLRAASPTSWGTYRSSAPLLEALPGPWRMASGFWKTA pfdn2-pfd1 1534233 n/a 1534237 unspecified role unspecified role prey prey n/a 1534238 unspecified role unspecified role bait bait n/a 1534239 inhibitor inhibitor unspecified role unspecified role physical association physical association false false false 3B pfdn2-pfdn1 1534233 n/a 1534238 unspecified role unspecified role bait bait n/a 1534237 unspecified role unspecified role prey prey physical association physical association false false false 3B f-pfdn2-1 1534234 n/a 1534238 unspecified role unspecified role bait bait v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1534239 unspecified role unspecified role prey prey egfp tag egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 1B f-pfdn2-2 1534235 n/a 1534239 unspecified role unspecified role neutral component neutral component gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1534238 unspecified role unspecified role neutral component neutral component v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false 2B f-pfdn2 1534236 n/a 1534239 unspecified role unspecified role bait bait n/a 1534238 unspecified role unspecified role prey prey physical association physical association false false false No figure