MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint postigo-2006-2 Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins Cell Death Differ. (1350-9047) 2006 rapid curation rapid curation postigo-2006-1 Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. unknown Unknown pull down pull down predetermined predetermined participant predetermined Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins Cell Death Differ. (1350-9047) 2006 rapid curation rapid curation postigo-2006-3 Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. unknown Unknown peptide array peptide array predetermined predetermined participant predetermined Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins Cell Death Differ. (1350-9047) 2006 rapid curation rapid curation postigo-2006-4 Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. unknown Unknown competition binding competition binding predetermined predetermined participant predetermined Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins Cell Death Differ. (1350-9047) 2006 rapid curation rapid curation postigo-2006-5 Interaction of F1L with the BH3 domain of Bak is responsible for inhibiting vaccinia-induced apoptosis. unknown Unknown chromatography chromatography technology column chromatography chromatography predetermined predetermined participant predetermined Postigo A., Cross JR., Downward J., Way M. Virus - Publications including interactions involving viral proteins Cell Death Differ. (1350-9047) 2006 rapid curation rapid curation f1_vaccw Protein F1 F1L VACWR040 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MLSMFMCNNIVDYVDDIDNGIVQDIEDEASNNVDHDYVYPLPENMVYRFDKSTNILDYLSTERDHVMMAVRYYMSKQRLDDLYRQLPTKTRSYIDIINIYCDKVSNDYNRDMNIMYDMASTKSFTVYDINNEVNTILMDNKGLGVRLATISFITELGRRCMNPVETIKMFTLLSHTICDDYFVDYITDISPPDNTIPNTSTREYLKLIGITAIMFATYKTLKYMIG mint bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG f1-bak1-2 759740 vf01_vaccw 759745 unspecified role unspecified role bait bait bak_human 759746 unspecified role unspecified role prey prey physical association physical association false false false F4 homomint mint bak1-bax 759740 bak_human 759746 unspecified role unspecified role bait bait bax_human 759747 unspecified role unspecified role prey prey physical association physical association false false false F6d homomint mint bax-bak1-3 759740 bax_human 759747 unspecified role unspecified role bait bait bak_human 759746 unspecified role unspecified role prey prey physical association physical association false false false F6d homomint mint bak1-f1 759741 vf01_vaccw 759745 unspecified role unspecified role prey prey bak_human 759746 unspecified role unspecified role bait bait physical association physical association false false false F4 homomint mint f1-bak1-1 759741 vf01_vaccw 759745 unspecified role unspecified role bait bait bak_human 759746 unspecified role unspecified role prey prey physical association physical association false false false F4 homomint mint f1-bak1-3 759742 vf01_vaccw 759745 unspecified role unspecified role bait bait bak_human 759746 unspecified role unspecified role prey prey physical association physical association false false false F5 homomint mint bak1-f1-1 759742 vf01_vaccw 759745 unspecified role unspecified role prey prey bak_human 759746 unspecified role unspecified role bait bait physical association physical association false false false F5 homomint mint bak1-f1-2 759743 vf01_vaccw 759745 unspecified role unspecified role neutral component neutral component bak_human 759746 unspecified role unspecified role neutral component neutral component physical association physical association false false false F6d, F7 homomint mint bak1-bak1 759744 bak_human 759746 unspecified role unspecified role self self bak_human 759746 unspecified role unspecified role self self physical association physical association false false false F7 homomint mint