HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html kiiver-2006-1 Complex formation between hepatitis C virus NS2 and NS3 proteins. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy immunostaining immunostaining Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com Virus Res. (0168-1702) 2006 imex curation Only protein-protein interactions imex curation kiiver-2006-3 Complex formation between hepatitis C virus NS2 and NS3 proteins. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com Virus Res. (0168-1702) 2006 imex curation Only protein-protein interactions imex curation kiiver-2006-2 Complex formation between hepatitis C virus NS2 and NS3 proteins. human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma confocal microscopy confocal microscopy immunostaining immunostaining Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com Virus Res. (0168-1702) 2006 imex curation Only protein-protein interactions imex curation kiiver-2006-4 Complex formation between hepatitis C virus NS2 and NS3 proteins. human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com Virus Res. (0168-1702) 2006 imex curation Only protein-protein interactions imex curation kiiver-2006-5 Complex formation between hepatitis C virus NS2 and NS3 proteins. human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kiiver K., Merits A., Ustav M., Zusinaite E. Virus - Publications including interactions involving viral proteins Eva Zusinaite@hotmail.com Virus Res. (0168-1702) 2006 imex curation Only protein-protein interactions imex curation p27958-pro_0000037573 Serine protease/helicase NS3 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQTYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPTGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAKGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADAGCSGGAYDIIICDECHSTDATSISGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLGFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMRKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEVVT 1027 1657 p27958-pro_0000037574 Non-structural protein 4A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STWVLVGGVLAALAAYCLSTGCVVIVGRIVLSGKPAIIPDREVLYQEFDEMEEC 1658 1711 p27958-pro_0000037572 Protease NS2 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) LDTEVAASCGGVVLVGLMALTLSPYYKRYISWCMWWLQYFLTRVEAQLHVWVPPLNVRGGRDAVILLTCVVHPALVFDITKLLLAIFGPLWILQASLLKVPYFVRVQGLLRICALARKIAGGHYVQMAIIKLGALTGTCVYNHLAPLRDWAHNGLRDLAVAVEPVVFSRMETKLITWGADTAACGDIINGLPVSARRGQEILLGPADGMVSKGWRLL 810 1026 ns3-ns4a-10 1457746 n/a NS3 1457751 unspecified role unspecified role neutral component neutral component n/a NS4A 1457752 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 3B ns2-ns3-7 1457746 n/a NS3 1457751 unspecified role unspecified role neutral component neutral component n/a NS2 1457753 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 3A ns3-ns4a-11 1457747 n/a NS3 1457751 unspecified role unspecified role bait bait ie2 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NS4A 1457752 unspecified role unspecified role prey prey 3f12 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5B and 5C ns3-ns2-1 1457747 n/a NS3 1457751 unspecified role unspecified role bait bait ie2 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NS2 1457753 unspecified role unspecified role prey prey 3f12 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6 ns2-ns3-2 1457748 n/a NS3 1457751 unspecified role unspecified role neutral component neutral component n/a NS2 1457753 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 4 ns3-ns2-3 1457749 n/a NS3 1457751 unspecified role unspecified role prey prey n/a NS2 1457753 unspecified role unspecified role bait bait 3f12 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 7B ns3-ns2-4 1457750 n/a NS3 1457751 unspecified role unspecified role bait bait n/a NS2 1457753 unspecified role unspecified role prey prey 3f12 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 7C