UniProt UniProt http://www.uniprot.org lingappa-2006-4 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lingappa JR., Dooher JE., Newman MA., Kiser PK., Klein KC. Virus - Publications including interactions involving viral proteins jais@u.washington.edu The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation Lingappa JR., Dooher JE., Newman MA., Kiser PK., Klein KC., Lingappa JR., Dooher JE., Newman MA., Kiser PK., Klein KC. lingappa-2006-1 chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lingappa JR., Dooher JE., Newman MA., Kiser PK., Klein KC. Virus - Publications including interactions involving viral proteins jais@u.washington.edu The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation Lingappa JR., Dooher JE., Newman MA., Kiser PK., Klein KC., Lingappa JR., Dooher JE., Newman MA., Kiser PK., Klein KC. lingappa-2006-2 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lingappa JR., Dooher JE., Newman MA., Kiser PK., Klein KC. Virus - Publications including interactions involving viral proteins jais@u.washington.edu The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation Lingappa JR., Dooher JE., Newman MA., Kiser PK., Klein KC., Lingappa JR., Dooher JE., Newman MA., Kiser PK., Klein KC. lingappa-2006-3 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lingappa JR., Dooher JE., Newman MA., Kiser PK., Klein KC. Virus - Publications including interactions involving viral proteins jais@u.washington.edu The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation Lingappa JR., Dooher JE., Newman MA., Kiser PK., Klein KC., Lingappa JR., Dooher JE., Newman MA., Kiser PK., Klein KC. abce1_human ATP-binding cassette sub-family E member 1 ABCE1 RLI RNASEL1 RNASELI RNS4I RNase L inhibitor Ribonuclease 4 inhibitor 2'-5'-oligoadenylate-binding protein HuHP68 OK/SW-cl.40 protein protein human Homo sapiens Human MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD p03347-1 Gag polyprotein Pr55Gag gag protein protein hv1b1 Human immunodeficiency virus type 1 group M subtype B (isolate BH10) (HIV-1) HIV-1 MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSSQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNTATIMMQRGNFRNQRKMVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPFLQSRPEPTAPPEESFRSGVETTTPPQKQEPIDKELYPLTSLRSLFGNDPSSQ Produced by conventional translation. abc3g_human DNA dC->dU-editing enzyme APOBEC-3G APOBEC-related cytidine deaminase APOBEC-related protein 9 CEM-15 APOBEC3G Deoxycytidine deaminase MDS019 protein protein human Homo sapiens Human MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRLRAILQNQEN q6ssd8_chlae protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGICIKKCPFGALSIVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLAGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAVVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVTMPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEFELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKSTGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPADVYLIDEPSAYLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD abce1-gag-3 1787956 N/A 1787960 unspecified role unspecified role bait bait N/A 1787961 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 5 Association is not sensitive to treatment with RNase A gag-apobec3g-1 1787956 N/A 1787962 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection myc-his tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 1787961 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 5 Association is lost upon treatment with RNase A gag-q6ssd8_chlae-1 1787957 N/A 1787963 unspecified role unspecified role bait bait N/A 1787961 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ch1/2a binding region binding-associated region binding region substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region substitution leads to a decrease in interaction strength. region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false kr10a required to bind necessary binding region required to bind substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region substitution leads to interaction disruption. P03347-1:p.Arg409_Lys411delinsGluGluGlu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false kr4e binding region binding-associated region binding region substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region substitution leads to a decrease in interaction strength. physical association physical association false false false 1, 2, 3 abce1-gag-1 1787958 N/A 1787961 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated ch2a binding region binding-associated region binding region substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region substitution leads to a decrease in interaction strength. ch1/2a binding region binding-associated region binding region substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region substitution leads to a decrease in interaction strength. kr10a required to bind necessary binding region required to bind substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region substitution leads to interaction disruption. region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ch1a binding region binding-associated region binding region substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region substitution leads to a decrease in interaction strength. region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 1787960 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 4 abce1-gag-2 1787959 N/A 1787961 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection ch2a binding region binding-associated region binding region substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region substitution leads to a decrease in interaction strength. ch1/2a binding region binding-associated region binding region substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region substitution leads to a decrease in interaction strength. kr10a required to bind necessary binding region required to bind substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region substitution leads to a interaction disruption. ch1a binding region binding-associated region binding region substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false Region substitution leads to a decrease in interaction strength. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 N/A 1787960 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 4c