MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint yedavalli-2005-1 Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. in vivo in vivo anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2005 yedavall-2005-1 Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2005 yedavall-2005-2 Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2005 yedavall-2005-3 Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2005 yedavall-2005-4 Human immunodeficiency virus type 1 Vpr interacts with antiapoptotic mitochondrial protein HAX-1. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Yedavalli VS., Shih HM., Chiang YP., Lu CY., Chang LY., Chen MY., Chuang CY., Dayton AI., Jeang KT., Huang LM. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2005 vpr_hv192 Protein Vpr R ORF protein Viral protein R vpr protein protein hv192 Human immunodeficiency virus type 1 group M subtype C (isolate 92BR025) MEQAPEDQGPQREPYNEWTLELLEELKREAVRHFPRPWLHGLGQHIYETYGDTWTGVEAIIRILQRLLFVHFRIGCQHSRIGILRQRRARNGASRS mint hax1_human HCLS1-associated protein X-1 HAX1 HS1BP1 HS1-associating protein X-1 HS1-binding protein 1 protein protein human Homo sapiens Human MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPGGGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR vpr-hax1 232355 o12160_9hiv1 232360 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 hax1_human 232361 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association false false false F1C SHORTLABEL=human MT4 cells homomint mint hax1-vpr 232356 o12160_9hiv1 232360 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 hax1_human 232361 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 physical association physical association false false false F4B F5B homomint mint vpr-hax1-1 232357 o12160_9hiv1 232360 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 hax1_human 232361 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 physical association physical association false false false F1A homomint mint vpr-hax1-2 232358 o12160_9hiv1 232360 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 hax1_human 232361 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction false false false F1B homomint mint hax1-vpr-1 232359 o12160_9hiv1 vpr 232360 anti tag immunost anti tag immunostaining anti tag immunost unspecified role unspecified role neutral component neutral component fixed cell fixed cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 hax1_human HAX1 232361 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 colocalization colocalization false false false F4A F3 F5A homomint mint