MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint senkevic-2005-1 Vaccinia virus H2 protein is an essential component of a complex involved in virus entry and cell-cell fusion. unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Senkevich TG., Moss B. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2005 rapid curation rapid curation senkevich-2005-1 Vaccinia virus H2 protein is an essential component of a complex involved in virus entry and cell-cell fusion. unknown Unknown density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Senkevich TG., Moss B. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2005 rapid curation rapid curation a28_vaccw Envelope protein A28 A28L VACWR151 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MNSLSIFFIVVATAAVCLLFIQGYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMQQCIDFTFSDVININIYNPCVVPNINNAECQFLKSVL Late protein Required for virus entry into host cell and for cell-cell fusion (syncytium formation) mint h2_vaccw Protein H2 H2R VACWR100 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MDKTTLSVNACNLEYVREKAIVGVQAAKTSTLIFFVIILAISALLLWFQTSDNPVFNELTRYMRIKNTVNDWKSLTDSKTKLESDRGRLLAAGKDDIFEFKCVDFGAYFIAMRLDKKTYLPQAIRRGTGDAWMVKKAAKVDPSAQQFCQYLIKHKSNNVITCGNEMLNELGYSGYFMSPHWCSDFSNME Late protein Required for virus entry into host cell and for cell-cell fusion (syncytium formation) mint h2-a28 759657 va28_vaccw 759659 unspecified role unspecified role prey prey vh02_vaccw 759660 unspecified role unspecified role bait bait physical association physical association false false false F11B homomint mint a28-h2-1 759657 va28_vaccw 759659 unspecified role unspecified role bait bait vh02_vaccw 759660 unspecified role unspecified role prey prey physical association physical association false false false F11B homomint mint a28-h2 759658 va28_vaccw 759659 unspecified role unspecified role neutral component neutral component vh02_vaccw 759660 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false F11A homomint mint