MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint cheng-2005-4 Werner syndrome protein associates with gamma H2AX in a manner that depends upon Nbs1. human-ws Homo sapiens Werner Syndrom (WS) cell line transformed with SV40 (AG11395 cell line) ws Human Werner Syndrome (WS) cell line transformed with SV40 (AG11395 cell line) imaging technique imaging technique microscopy predetermined predetermined participant predetermined Cheng WH., Sakamoto S., Fox JT., Komatsu K., Carney J., Bohr VA. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation cheng-2005-1 Werner syndrome protein associates with gamma H2AX in a manner that depends upon Nbs1. human-mrc5 Human foetal lung fibroblast-like cell line mrc5 Human foetal lung fibroblast-like cell line fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Cheng WH., Sakamoto S., Fox JT., Komatsu K., Carney J., Bohr VA. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation cheng-2005-2 Werner syndrome protein associates with gamma H2AX in a manner that depends upon Nbs1. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cheng WH., Sakamoto S., Fox JT., Komatsu K., Carney J., Bohr VA. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation cheng-2005-3 Werner syndrome protein associates with gamma H2AX in a manner that depends upon Nbs1. in vivo in vivo anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Cheng WH., Sakamoto S., Fox JT., Komatsu K., Carney J., Bohr VA. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2005 2009-01-08 Only protein-protein interactions imex curation h2ax_human Histone H2AX H2AX H2AFX Histone H2A.X protein protein human Homo sapiens Human MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY wrn_human Werner syndrome ATP-dependent helicase WRN RECQ3 RECQL2 Exonuclease WRN RecQ protein-like 2 DNA helicase, RecQ-like type 3 protein protein human Homo sapiens Human MSEKKLETTAQQRKCPEWMNVQNKRCAVEERKACVRKSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILDDTVQRFAINKEEEILLSDMNKQLTSISEEVMDLAKHLPHAFSKLENPRRVSILLKDISENLYSLRRMIIGSTNIETELRPSNNLNLLSFEDSTTGGVQQKQIREHEVLIHVEDETWDPTLDHLAKHDGEDVLGNKVERKEDGFEDGVEDNKLKENMERACLMSLDITEHELQILEQQSQEEYLSDIAYKSTEHLSPNDNENDTSYVIESDEDLEMEMLKHLSPNDNENDTSYVIESDEDLEMEMLKSLENLNSGTVEPTHSKCLKMERNLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCLKMYFGHSSFKPVQWKVIHSVLEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLKMSNIPACFLGSAQSENVLTDIKLGKYRIVYVTPEYCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHDFRDSFRKLGSLKTALPMVPIVALTATASSSIREDIVRCLNLRNPQITCTGFDRPNLYLEVRRKTGNILQDLQPFLVKTSSHWEFEGPTIIYCPSRKMTQQVTGELRKLNLSCGTYHAGMSFSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYGAPKDMESYYQEIGRAGRDGLQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKMEKYLHSSRCRRQIILSHFEDKQVQKASLGIMGTEKCCDNCRSRLDHCYSMDDSEDTSWDFGPQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFGTGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNWLHKANTESQSLILQANEELCPKKLLLPSSKTVSSGTKEHCYNQVPVELSTEKKSNLEKLYSYKPCDKISSGSNISKKSIMVQSPEKAYSSSQPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSSTKPQEEQKTSLVAKNKICTLSQSMAITYSLFQEKKMPLKSIAESRILPLMTIGMHLSQAVKAGCPLDLERAGLTPEVQKIIADVIRNPPVNSDMSKISLIRMLVPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS nalp2_human NACHT, LRR and PYD domains-containing protein 2 NLRP2 NALP2 NBS1 PAN1 PYPAF2 Nucleotide-binding site protein 1 PYRIN domain and NACHT domain-containing protein 1 PYRIN-containing APAF1-like protein 2 protein protein human Homo sapiens Human MVSSAQMGFNLQALLEQLSQDELSKFKYLITTFSLAHELQKIPHKEVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVICLGKEVFKGKKPDKDNRCRYILKTKFREMWKSWPGDSKEVQVMAERYKMLIPFSNPRVLPGPFSYTVVLYGPAGLGKTTLAQKLMLDWAEDNLIHKFKYAFYLSCRELSRLGPCSFAELVFRDWPELQDDIPHILAQARKILFVIDGFDELGAAPGALIEDICGDWEKKKPVPVLLGSLLNRVMLPKAALLVTTRPRALRDLRILAEEPIYIRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRFLCSRFPQGAQLRGALRTLSLLAAQGLWAQTSVLHREDLERLGVQESDLRLFLDGDILRQDRVSKGCYSFIHLSFQQFLTALFYTLEKEEEEDRDGHTWDIGDVQKLLSGVERLRNPDLIQAGYYSFGLANEKRAKELEATFGCRMSPDIKQELLRCDISCKGGHSTVTDLQELLGCLYESQEEELVKEVMAQFKEISLHLNAVDVVPSSFCVKHCRNLQKMSLQVIKENLPENVTASESDAEVERSQDDQHMLPFWTDLCSIFGSNKDLMGLAINDSFLSASLVRILCEQIASDTCHLQRVVFKNISPADAHRNLCLALRGHKTVTYLTLQGNDQDDMFPALCEVLRHPECNLRYLGLVSCSATTQQWADLSLALEVNQSLTCVNLSDNELLDEGAKLLYTTLRHPKCFLQRLSLENCHLTEANCKDLAAVLVVSRELTHLCLAKNPIGNTGVKFLCEGLRYPECKLQTLVLWNCDITSDGCCDLTKLLQEKSSLLCLDLGLNHIGVKGMKFLCEALRKPLCNLRCLWLWGCSIPPFSCEDLCSALSCNQSLVTLDLGQNPLGSSGVKMLFETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHPWAERPSSHDFMI h2afx-wrn-2 173876 h2ax_human 173880 experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 wrn_human 173881 experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization false false false F4 BIOSOURCE=NBS cells. The interaction occurs after 3 hours of gamma-irradiation. The WRN association with H2AX depends upon Nbs1 expression and Nbs1 Ser-343 phosphorylation homomint mint h2afx-nlrp2-1 173876 h2ax_human 173880 experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 nalp2_human 173882 experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization false false false F5 BIOSOURCE=MRC-5 cells. The interaction occurs after 6 hours of gamma-irradiation. The co-localization of Nbs1 with H2AX is indipendent of WRN expression homomint mint h2afx-nlrp2-2 173876 h2ax_human 173880 experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 nalp2_human 173882 experimental particp experimental participant identification experimental particp unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization false false false F5 BIOSOURCE=WS cells. The interaction occurs after 6 hours of gamma-irradiation. The co-localization of Nbs1 with H2AX is indipendent of WRN expression homomint mint h2afx-wrn 173877 h2ax_human 173880 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 wrn_human 173881 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization false false false F1B homomint mint wrn-h2afx 173877 h2ax_human 173880 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 wrn_human 173881 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 colocalization colocalization false false false F2 SHOTLABEL=NBS cells. The interaction occurs in the insoluble fraction and after 3 hours of gamma-irradiation. The WRN association with H2AX depends upon Nbs1 expression and Nbs1 Ser-343 phosphorylation homomint mint h2afx-wrn-1 173878 h2ax_human 173880 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 wrn_human 173881 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false The M/R/N complex enhances the association of WRN with H2Ax F6A F6B homomint mint h2afx-nlrp2 173878 h2ax_human 173880 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait purified purified tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 1.0 nalp2_human 173882 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association false false false F6 Treatment with PP1 phosphatase abolish the association of Nbs1 with H2Ax homomint mint wrn-h2afx-1 173879 h2ax_human 173880 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 wrn_human 173881 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association false false false F1A SHOTLABEL=MRC-5 cells. The interaction occurs in the soluble fraction and after 3 hours of gamma-irradiation. homomint mint wrn-nlrp2 173879 wrn_human 173881 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 nalp2_human 173882 monoclonal western monoclonal antibody western blot monoclonal western unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association false false false F1A SHOTLABEL=MRC-5 cells. The interaction occurs in the insoluble fraction and after 3 hours of gamma-irradiation. homomint mint