HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html levy-2003-3 in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified hkung@ucdavis.edu hkung @ucdavis.edu Journal of virology 2003 imex curation virus strain not specified and the reference uniprot id Q9DGW5 is used instaed Only protein-protein interactions imex curation levy-2003-1 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified hkung@ucdavis.edu hkung @ucdavis.edu Journal of virology 2003 imex curation virus strain not specified and the reference uniprot id Q9DGW5 is used instaed Only protein-protein interactions imex curation levy-2003-2 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified hkung@ucdavis.edu hkung @ucdavis.edu Journal of virology 2003 imex curation virus strain not specified and the reference uniprot id Q9DGW5 is used instaed Only protein-protein interactions imex curation levy-2003-4 chick-msb-1 chick lymphoblastoid cell line Chicken msb-1 chicken lymphoblastoid cell line MSB-1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified hkung@ucdavis.edu hkung @ucdavis.edu Journal of virology 2003 imex curation virus strain not specified and the reference uniprot id Q9DGW5 is used instaed Only protein-protein interactions imex curation levy-2003-5 chick-msb-1 chick lymphoblastoid cell line Chicken msb-1 chicken lymphoblastoid cell line MSB-1 confocal microscopy confocal microscopy immunostaining immunostaining Levy AM., Izumiya Y., Brunovskis P., Xia L., Parcells MS., Reddy SM., Lee L., Chen HW., Kung HJ. Virus - Publications including interactions involving viral proteins interaction between Meq and CREB, ATF1, 2 and 3 is not captured since the host species is not specified hkung@ucdavis.edu hkung @ucdavis.edu Journal of virology 2003 imex curation virus strain not specified and the reference uniprot id Q9DGW5 is used instaed Only protein-protein interactions imex curation meq_gahvm Oncoprotein MEQ MDV005 MDV076 protein protein gahvm Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GaHV-2 Marek's disease herpesvirus type 1 MSQEPEPGAMPYSPADDPSPLDLSLGSTSRRKKRKSHDIPNSPSKHPFPDGLSEEEKQKLERRRKRNRDAARRRRRKQTDYVDKLHEACEELQRANEHLRKEIRDLRTECTSLRVQLACHEPVCPMAVPLTVTLGLLTTPHDPVPEPPICTPPPPSPDEPNAPHCSGSQPPICTPPPPDTEELCAQLCSTPPPPISTPHIIYAPGPSPLQPPICTPAPPDAEELCAQLCSTPPPPICTPHSLFCPPQPPSPEGIFPALCPVTEPCTPPSPGTVYAQLCPVGQVPLFTPSPPHPAPEPERLYARLTEDPEQDSLYSGQIYTQFPSDTQSTVWWFPGDGRP mdv-ori ss dna single stranded deoxyribonucleic acid ss DNA ss dna Gallid herpesvirus 2 Gallid herpesvirus 2 ACACA jun_rat Transcription factor AP-1 Jun Rjg-9 Activator protein 1 V-jun avian sarcoma virus 17 oncogene homolog Proto-oncogene c-Jun protein protein rat Rattus norvegicus (Rat) Rat MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGALSSGGGAPSYGATGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF mint Transcription factor that recognizes and binds to the enhancer heptamer motif 5'-TGA[CG]TCA-3' cre cyclic AMP response element ss dna single stranded deoxyribonucleic acid ss DNA ss dna rat Rattus norvegicus (Rat) Rat TGACGTCA tre c-Jun promoter probe ss dna single stranded deoxyribonucleic acid ss DNA ss dna chick Gallus gallus (Chicken) Chicken TGACATCA fos_rat Proto-oncogene c-Fos Fos Cellular oncogene fos protein protein rat Rattus norvegicus (Rat) Rat MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANFIPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTPSTGAYARAGVVKTMSGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPNDLGFPEEMSVTSLDLTGGLPEATTPESEEAFTLPLLNDPEPKPSLEPVKNISNMELKAEPFDDFLFPASSRPSGSETARSVPDVDLSGSFYAADWEPLHSSSLGMGPMVTELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL mint Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation jun_chick Transcription factor AP-1 Proto-oncogene c-Jun JUN protein protein chick Gallus gallus (Chicken) Chicken MSAKMEPTFYEDALNASFAPPESGGYGYNNAKVLKQSMTLNLSDAASSLKPHLRNKNADILTSPDVGLLKLASPELERLIIQSSNGLITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHNQNTLPSVTSAAQPVSGGMAPVSSMAGGGSFNTSLHSEPPVYANLSNFNPNALNSAPNYNANGMGYAPQHHINPQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF junb_mouse Transcription factor jun-B Junb Jun-b MyD21 protein protein mouse Mus musculus Mouse MCTKMEQPFYHDDSYAAAGYGRSPGSLSLHDYKLLKPTLALNLADPYRGLKGPGARGPGPEGSGAGSYFSGQGSDTGASLKLASTELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGTGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGASGGPQAGPGGVYAGPEPPPVYTNLSSYSPASAPSGGSGTAVGTGSSYPTATISYLPHAPPFAGGHPAQLGLSRGASAFKEEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTLKAENAGLSSAAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF meq-meq-2 1916114 N/A 1916119 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 1916119 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) N/A 1916120 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 1C meq-jun-3 1916114 N/A 1916121 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1916122 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1916119 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1C meq-jun-4 1916114 N/A 1916121 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1916123 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1916119 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1C meq-fos-1 1916114 N/A 1916124 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1916123 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1916119 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1C meq-fos-2 1916114 N/A 1916124 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 1916122 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1916119 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1C jun-meq-1 1916115 N/A 1916125 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1916119 unspecified role unspecified role prey prey 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A junb-meq-1 1916115 N/A 1916126 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1916119 unspecified role unspecified role prey prey 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A mdv005-jun-1 1916116 N/A 1916125 unspecified role unspecified role prey prey 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1916119 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A mdv005-junb-1 1916116 N/A 1916126 unspecified role unspecified role prey prey 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 1916119 unspecified role unspecified role bait bait 35s label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A meq-cjun-3 1916117 N/A 1916125 unspecified role unspecified role prey prey N/A 1916119 unspecified role unspecified role bait bait physical association physical association false false false 3A meq-jun-2 1916118 N/A 1916125 unspecified role unspecified role neutral component neutral component N/A 1916119 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3B