MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint loomis-2003-1 Binding partners for the UL11 tegument protein of herpes simplex virus type 1. unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Loomis JS., Courtney RJ., Wills JW. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2003 rapid curation rapid curation loomis-2003-2 Binding partners for the UL11 tegument protein of herpes simplex virus type 1. unknown Unknown pull down pull down predetermined predetermined participant predetermined Loomis JS., Courtney RJ., Wills JW. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2003 rapid curation rapid curation cep3_hhv11 Cytoplasmic envelopment protein 3 UL11 protein protein hhv11 Human herpesvirus 1 (strain 17) (HHV-1) Human herpes simplex virus 1 HHV-1 MGLSFSGARPCCCRNNVLITDDGEVVSLTAHDFDVVDIESEEEGNFYVPPDMRGVTRAPGRQRLRSSDPPSRHTHRRTPGGACPATQFPPPMSDSE mint cep2_hhv11 Cytoplasmic envelopment protein 2 UL16 protein protein hhv11 Human herpesvirus 1 (strain 17) (HHV-1) Human herpes simplex virus 1 HHV-1 MAQLGPRRPLAPPGPPGTLPRPDSRAGARGTRDRVDDLGTDVDSIARIVNSVFVWRVVRADERLKIFRCLTVLTEPLCQVALPNPDPGRALFCEIFLYLTRPKALRLPPNTFFALFFFNRERRYCAIVHLRSVTHPLTPLLCTLTFARIRAATPPEETPDPTTEQLAEEPVVGELDGAYLVPAKTPPEPGACCALGPGAWWHLPSGQIYCWAMDSDLGSLCPPGSRARHLGWLLARITNHPGGCESCAPPPHIDSANALWLSSVVTESCPCVAPCLWAKMAQCTLAVQGDASLCPLLFGHPVDTVTLLQAPRRPCITDRLQEVVGGRCGADNIPPTSAGWRLCVFSSYISRLFATSCPTVARAVARASSSDPE mint teg2-ul16 758638 tg11_hhv11 758640 unspecified role unspecified role bait bait ul16_hhv11 758641 unspecified role unspecified role prey prey physical association physical association false false false F1 homomint mint teg2-ul16-1 758639 ul16_hhv11 758641 unspecified role unspecified role prey prey tg11_hhv11 758640 unspecified role unspecified role bait bait physical association physical association false false false F2 F3 homomint mint