HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html moriishi-2003-3 Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp J. Virol. (0022-538X) 2003 imex curation Only protein-protein interactions imex curation moriishi-2003-5 Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp J. Virol. (0022-538X) 2003 imex curation Only protein-protein interactions imex curation moriishi-2003-1 Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins Human fetal brain and liver cDNA matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp J. Virol. (0022-538X) 2003 imex curation Only protein-protein interactions imex curation moriishi-2003-2 Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp J. Virol. (0022-538X) 2003 imex curation Only protein-protein interactions imex curation moriishi-2003-4 Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. mouse-liver Mus musculus liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp J. Virol. (0022-538X) 2003 imex curation Only protein-protein interactions imex curation moriishi-2003-6 Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp J. Virol. (0022-538X) 2003 imex curation Only protein-protein interactions imex curation moriishi-2003-7 Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp J. Virol. (0022-538X) 2003 imex curation Only protein-protein interactions imex curation moriishi-2003-8 Proteasome activator PA28gamma-dependent nuclear retention and degradation of hepatitis C virus core protein. human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Moriishi K., Okabayashi T., Nakai K., Moriya K., Koike K., Murata S., Chiba T., Tanaka K., Suzuki R., Suzuki T., Miyamura T., Matsuura Y. Virus - Publications including interactions involving viral proteins matsuura@biken .osaka-u.ac.jp. matsuura@biken.osaka-u.ac.jp J. Virol. (0022-538X) 2003 imex curation Only protein-protein interactions imex curation psme3_human Proteasome activator complex subunit 3 PSME3 Proteasome activator 28 subunit gamma Activator of multicatalytic protease subunit 3 11S regulator complex subunit gamma Ki nuclear autoantigen protein protein human Homo sapiens Human MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY o93077_9hepc Core protein precursor Mature core protein NS3 helicase NS3 protease Protease NS2 Serine protease/helicase NS3 Viroporin p7 Viroporin p70 p23 p56/58 Envelope glycoprotein E1 Envelope glycoprotein E2 Genome polyprotein Gp32 Hepacivirin NS1 NS3P NS5B Non-structural protein 4A Non-structural protein 4B Non-structural protein 5A RNA-directed RNA polymerase gp35 gp68 gp70 p21 p27 p68 p8 protein protein 9hepc Hepatitis C virus MSTNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPNDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTIPASAYEVRNVSGIYHVTNDCSNSSIVYEAADVIMHAPGCVPCVRENNSSRCWVALTPTLAARNASVPTTTLRRHVDLLVGTAAFCSAMYVGDLCGSVFLISQLFTFSPRRHETVQDCNCSIYPGHVSGHRMAWDMMMNWSPTAALVVSQLLRIPQAVMDMVAGAHWGVLAGLAYYSMVGNWAKVLIVMLLFAGVDGHTRVTGGVQGHVTSTLTSLFRPGASQKIQLVNTNGSWHINRTALNCNDSLKTGFLAALFYTHKFNASGCPERMASCRSIDKFDQGWGPITYAQPDNSDQRPYCWHYAPRQCGIVPASQVCGPVYCFTPSPVVVGTTDRFGAPTYNWGDNETDVLLLNNTRPPHGNWFGCTWMNSTGFTKTCGGPPCNIRGVGNNTLTCPTDCFRKHPDATYTKCGSGPWLTPRCLVDYPYRLWHYPCTVNFTIFKVRMYVGGVEHRLDAACNWTRGERCDLEDRDRAELSPLLLSTTEWQILPCSYTTLPALSTGLIHLHQNIVDIQYLYGIGSAVVSIAIKWEYVVLLFLLLADARVCACLWMMLLIAQAEAALENLVVLNAASVVGAHGMLPFFMFFCAAWYMKGRLVPGAAYAFYGVWPLLLLLLALPPRAYAMDREMVASCGGGVFVGLALLTLSPYCKVFLARLIWWLQYFITKAEAHLQVSLPPLNVRGGRDAIILLMCAVHPELIFDITKLLLSILGPLMVLQASLIRVPYFVRAQGLIRACMLVRKAAGGHYVQMAFVKLAALTGTYVYDHLTPLQDWAHVGLRDLAVAVEPVVFSAMETKVITWGADTAACGDIISGLPVSARRGKEILLGPADSFEGQGWRLLAPITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTAKQSFLATCVNGACWTVFHGAGSKTLAAAKGPITQMYTNVDQDLVGWPAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESMETTMRSPVFTDNSTPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYMVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIICDECHSTDSTSILGIGTVLDQAETVGARFVVLATATPPGSITFPHPNIEEVPLANTGEIPFYAKTIPIEVIRGGRHLIFCHSKKKCDELPAKLSALGLNAVAYYRGLDVSVIPASGDVVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRTQRRGRTGRGRRGIYRFVTPGERPSAMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAKAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVTSTWVLVGGVLAALAAYCLTTGSVVIVGRIILSGRPAVIPDREVLYQEFDEMEECASHLPYIEQGMQLAEQFKQKALGLLQTATKQAEAAAPVVESKWRALETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTASITSPLATQYTLLFNILGGWVAAQLAPPSAASAFVGAGIAGAAVGSIGLGKVLVDILAGYGAGVAGALVAFKVMSGDMPSTEDLVNLLPAILSPGALVVGVVCAAILRRHVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTQILSNLTITQLLKRLHQWINEDCSTPCSGSWLRDVWDWICTVLADFKTWLQSKLLPRLPGVPFFSCQRGYKGVWRGDGIMYTTCPCGAQITGHVKNGSMRIVGPRTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTELDGVRLHRYAPACKPLLRDEVTFQVGLNQYTVGSQLPCEPEPDVTVVTSMLTDPSHITAEAARRRLARGSPPSLAGSSASQLSALSLKATCTTHHGAPDTDLIEANLLWRQEMGGNITRVESENKIVILDSFEPLRAEEDEREVSAAAEILRKTRKFPAAMPVWARPDYNPPLLESWKNPDYVPPVVHGCPLPPTKAPPIPPPRRKRTVVLTESTVSSALAELATKTFGGSGSSAVDSGTATGPPDQASAEGDAGSDAESYSSMPPLEGEPGDPDLSDGSWSTVSEEASEDVVCCSMSYTWTGALITPCAAEESKLPINALSNPLLRHHNMVYSTTSRSASLRQKKVTFDRMQVLDDHYRDVLKEMKAKASTVKAKLLSVEEACKLTPPHSAKSKFGYGAKDVRSLSSRAVNHIRSVWKDLLEDTDTPIQTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSTLPQAVMGSSYGFQYSPKQRVEFLVNTWKAKKCPMGFSYDTRCFDSTVTENDIRVEESIYQCCDLAPEARQAIRSLTERLYIGGPMTNSKGQNCGYRRCRASGVLTTSCGNTLTCYLKAAAACRAAKLQDCTMLVCGDDLVVICDSAGTQEDAASLRVFTEAMTRYSAPPGDPPQPEYDLELITSCSSNVSVAHDASGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMYAPTLWARMILMTHFFSILLAQEQLEKALDCQIYGATYSIEPLDLPQIIQRLHGLSAFSLHSYSPGEINRVASCLRKLGVPPLRVWRHRARSVRAKLLSQGGRAATCGKYLFNWAVKTKLKLTPIPEASQLDLSGWFVAGYSGGDIYHSLSRARPRWFMWCLLLLSVGVGIYLLPNR psme3_mouse Proteasome activator complex subunit 3 Psme3 11S regulator complex subunit gamma Activator of multicatalytic protease subunit 3 Ki nuclear autoantigen Proteasome activator 28 subunit gamma protein protein mouse Mus musculus Mouse MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY core-pa28delta-2 1545875 n/a 1545883 unspecified role unspecified role prey prey n/a Core 1545884 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 2B core-pa28delta-3 1545875 n/a 1545884 unspecified role unspecified role bait bait n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1545883 unspecified role unspecified role prey prey physical association physical association false false false 4, 6A and 9 core-pa28delta-8 1545875 n/a 1545884 unspecified role unspecified role bait bait n terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1545883 unspecified role unspecified role prey prey physical association physical association false false false 6C psme3-o93077-2 1545876 n/a 1545884 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1545883 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3 o93077-psme3-1 1545876 n/a 1545884 unspecified role unspecified role neutral component neutral component n terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1545883 unspecified role unspecified role neutral component neutral component rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 5A psme3-o93077-1 1545876 n/a 1545883 unspecified role unspecified role neutral component neutral component rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false regions mutation mutation range range range range false range range range range false n/a 1545884 unspecified role unspecified role neutral component neutral component n terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false 5A core-pa28delta-5 1545877 n/a 1545883 unspecified role unspecified role prey prey n/a Core 1545884 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false No figure core-pa28delta-1 1545878 n/a 1545883 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a Core 1545884 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2A core-pa28delta-4 1545879 n/a 1545884 unspecified role unspecified role bait bait core_region sufficient to bind sufficient binding region sufficient to bind range range range range false n/a 1545885 unspecified role unspecified role prey prey physical association physical association false false false 2C core-pa28delta-7 1545880 n/a 1545883 unspecified role unspecified role prey prey n/a 1545884 unspecified role unspecified role bait bait n terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 5C core-pa28delta-9 1545881 n/a 1545883 unspecified role unspecified role bait bait n/a 1545884 unspecified role unspecified role prey prey n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 6A core-psme3-1 1545882 n/a 1545884 unspecified role unspecified role bait bait core_region sufficient to bind sufficient binding region sufficient to bind range range range range false n/a 1545883 unspecified role unspecified role prey prey physical association physical association false false false 2D