HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html erdtmann-2003-2 The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr J. Biol. Chem. (0021-9258) 2003 imex curation Only protein-protein interactions imex curation erdtmann-2003-3 The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr J. Biol. Chem. (0021-9258) 2003 imex curation Only protein-protein interactions imex curation erdtmann-2003-1 The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. in vitro In vitro 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr Human liver cDNA J. Biol. Chem. (0021-9258) 2003 imex curation Only protein-protein interactions imex curation erdtmann-2003-4 The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr J. Biol. Chem. (0021-9258) 2003 imex curation Only protein-protein interactions imex curation erdtmann-2003-5 The hepatitis C virus NS2 protein is an inhibitor of CIDE-B-induced apoptosis. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Erdtmann L., Franck N., Lerat H., Le Seyec J., Gilot D., Cannie I., Gripon P., Hibner U., Guguen-Guillouzo C. Virus - Publications including interactions involving viral proteins lars. erdtmann@univ-rennes1.fr J. Biol. Chem. (0021-9258) 2003 imex curation Only protein-protein interactions imex curation cideb_human Cell death activator CIDE-B CIDEB Cell death-inducing DFFA-like effector B protein protein human Homo sapiens Human MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY p27958-pro_0000037572 Protease NS2 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) LDTEVAASCGGVVLVGLMALTLSPYYKRYISWCMWWLQYFLTRVEAQLHVWVPPLNVRGGRDAVILLTCVVHPALVFDITKLLLAIFGPLWILQASLLKVPYFVRVQGLLRICALARKIAGGHYVQMAIIKLGALTGTCVYNHLAPLRDWAHNGLRDLAVAVEPVVFSRMETKLITWGADTAACGDIINGLPVSARRGQEILLGPADGMVSKGWRLL 810 1026 cideb-ns2-1 1435125 n/a CIDE-B 1435130 unspecified role unspecified role unspecified role unspecified role n/a NS2 1435131 unspecified role unspecified role unspecified role unspecified role region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2A cideb-cideb-1 1435125 n/a CIDE-B 1435130 unspecified role unspecified role bait bait n/a CIDE-B 1435130 unspecified role unspecified role prey prey Q9UHD4:p.Tyr160Phe mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1B, 3B and 3D p27958_pro-cideb-1 1435125 n/a NS2 1435131 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a CIDE-B 1435130 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9UHD4:p.Tyr160Phe mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false 1435145 1435143 physical association physical association false false false Fig. 3B, 3D cide-b-cide-b-1 1435126 n/a CIDE-B 1435130 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a CIDE-B 1435130 unspecified role unspecified role unspecified role unspecified role gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false Fig. 2B and 3C p27958_pro-cideb-2 1435126 n/a NS2 1435131 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a CIDE-B 1435130 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro 1435159 1435155 physical association physical association false false false Fig. 2B and 3C ns2-cide-b-1 1435127 n/a NS2 1435131 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a CIDE-B 1435130 unspecified role unspecified role prey prey human-liver Homo sapiens liver liver liver physical association physical association false false false Fig. 1A cideb-ns2-3 1435128 n/a NS2 1435131 unspecified role unspecified role neutral component neutral component gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a CIDE-B 1435130 unspecified role unspecified role neutral component neutral component flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 4A cideb-ns2-4 1435129 n/a NS2 1435131 unspecified role unspecified role prey prey gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). n/a CIDE-B 1435130 electron acceptor electron acceptor bait bait ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 4B