MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kzhyshko-2003-2 Regulation of transcription by the heterogeneous nuclear ribonucleoprotein E1B-AP5 is mediated by complex formation with the novel bromodomain-containing protein BRD7. unknown Unknown pull down pull down predetermined predetermined participant predetermined Kzhyshkowska J., Rusch A., Wolf H., Dobner T. Virus - Publications including interactions involving viral proteins julia.kzhyshkowska@haut.ma.uni-heidelberg.de Biochem. J. (0264-6021) 2003 rapid curation rapid curation kzhyshko-2003-1 Regulation of transcription by the heterogeneous nuclear ribonucleoprotein E1B-AP5 is mediated by complex formation with the novel bromodomain-containing protein BRD7. unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kzhyshkowska J., Rusch A., Wolf H., Dobner T. Virus - Publications including interactions involving viral proteins julia.kzhyshkowska@haut.ma.uni-heidelberg.de Biochem. J. (0264-6021) 2003 rapid curation rapid curation kzhyshkowsk-2003-1 Regulation of transcription by the heterogeneous nuclear ribonucleoprotein E1B-AP5 is mediated by complex formation with the novel bromodomain-containing protein BRD7. unknown Unknown fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Kzhyshkowska J., Rusch A., Wolf H., Dobner T. Virus - Publications including interactions involving viral proteins julia.kzhyshkowska@haut.ma.uni-heidelberg.de Biochem. J. (0264-6021) 2003 rapid curation rapid curation kzhyshko-2003-3 Regulation of transcription by the heterogeneous nuclear ribonucleoprotein E1B-AP5 is mediated by complex formation with the novel bromodomain-containing protein BRD7. unknown Unknown anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Kzhyshkowska J., Rusch A., Wolf H., Dobner T. Virus - Publications including interactions involving viral proteins julia.kzhyshkowska@haut.ma.uni-heidelberg.de Biochem. J. (0264-6021) 2003 rapid curation rapid curation brd7_human Bromodomain-containing protein 7 75 kDa bromodomain protein Protein CELTIX-1 BRD7 BP75 CELTIX1 protein protein human Homo sapiens Human MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKPLTSSLAKQEEVEQTPLQEALNQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFSTMKEKIKNNDYQSIEELKDNFKLMCTNAMIYNKPETIYYKAAKKLLHSGMKILSQERIQSLKQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSGDAEAHAFKSPSKENKKKDKDMLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTTLGLLHPVDPIVGEPGYCPVRLGMTTGRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFANISKDDSDLIYSTYGEDSDLPSDFSIHEFLATCQDYPYVMADSLLDVLTKGGHSRTLQEMEMSLPEDEGHTRTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVTNFGVPVEVFDSEEAEIFQKKLDETTRLLRELQEAQNERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDVAECGPGGS hnrl1_human Heterogeneous nuclear ribonucleoprotein U-like protein 1 E1BAP5 HNRNPUL1 HNRPUL1 Adenovirus early region 1B-associated protein 5 E1B-55 kDa-associated protein 5 protein protein human Homo sapiens Human MDVRRLKVNELREELQRRGLDTRGLKAELAERLQAALEAEEPDDERELDADDEPGRPGHINEEVETEGGSELEGTAQPPPPGLQPHAEPGGYSGPDGHYAMDNITRQNQFYDTQVIKQENESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIRGTVGPKSKAECEILMMVGLPAAGKTTWAIKHAASNPSKKYNILGTNAIMDKMRVMGLRRQRNYAGRWDVLIQQATQCLNRLIQIAARKKRNYILDQTNVYGSAQRRKMRPFEGFQRKAIVICPTDEDLKDRTIKRTDEEGKDVPDHAVLEMKANFTLPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGGFRGRGGGGGFQRYENRGPPGGNRGGFQNRGGGSGGGGNYRGGFNRSGGGGYSQNRWGNNNRDNNNSNNRGSYNRAPQQQPPPQQPPPPQPPPQQPPPPPSYSPARNPPGASTYNKNSNIPGSSANTSTPTVSSYSPPQPSYSQPPYNQGGYSQGYTAPPPPPPPPPAYNYGSYGGYNPAPYTPPPPPTAQTYPQPSYNQYQQYAQQWNQYYQNQGQWPPYYGNYDYGSYSGNTQGGTSTQ h2a1a_human Histone H2A type 1-A H2AC1 H2A-clustered histone 1 H2AFR HIST1H2AA Histone H2A/r protein protein human Homo sapiens Human MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHHHKAQSK h2b1a_human Histone H2B type 1-A HIST1H2BA Histone H2B, testis TSH2B H2BC1 Testis-specific histone H2B protein protein human Homo sapiens Human MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK h31_human Histone H3.1 H3FA H3FL H3FD H3FI H3FH H3FK H3FF H3FJ H3FB Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l H3C1 HIST1H3A H3C2 HIST1H3B H3C3 H3FC HIST1H3C H3C4 HIST1H3D H3C6 HIST1H3E H3C7 HIST1H3F H3C8 HIST1H3G H3C10 HIST1H3H H3C11 HIST1H3I H3C12 HIST1H3J protein protein human Homo sapiens Human MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA h4_human Histone H4 H4-16 H4C1 H4C11 H4C12 H4C13 H4C14 H4C15 H4C2 H4C3 H4C4 H4C5 H4C6 H4C8 H4C9 H4/A H4/B H4/C H4/D H4/E H4/G H4/H H4/I H4/J H4/K H4/M H4/N H4/O H4F2 H4FA H4FB H4FC H4FD H4FE H4FG H4FH H4FI H4FJ H4FK H4FM H4FN H4FO HIST1H4A HIST1H4B HIST1H4C HIST1H4D HIST1H4E HIST1H4F HIST1H4H HIST1H4I HIST1H4J HIST1H4K HIST1H4L HIST2H4 HIST2H4A HIST2H4B HIST4H4 protein protein human Homo sapiens Human MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG brd7-hnrnpul1 744966 brd7_human 744970 unspecified role unspecified role bait bait hnrl1_human 744971 unspecified role unspecified role prey prey physical association physical association false false false F4B C homomint mint hnrnpul1-brd7-1 744966 brd7_human 744970 unspecified role unspecified role prey prey hnrl1_human 744971 unspecified role unspecified role bait bait physical association physical association false false false F4D homomint mint brd7-hist1h2aa 744966 h2a1a_human 744972 unspecified role unspecified role prey prey brd7_human 744970 unspecified role unspecified role bait bait physical association physical association false false false F6 homomint mint brd7-hist1h2ba 744966 h2b1a_human 744973 unspecified role unspecified role prey prey brd7_human 744970 unspecified role unspecified role bait bait physical association physical association false false false F6 homomint mint brd7-hist1h3b 744966 brd7_human 744970 unspecified role unspecified role bait bait h31_human 744974 unspecified role unspecified role prey prey physical association physical association false false false F6 homomint mint brd7-hist1h4a 744966 h4_human 744975 unspecified role unspecified role prey prey brd7_human 744970 unspecified role unspecified role bait bait physical association physical association false false false F6 homomint mint hnrnpul1-brd7 744967 brd7_human 744970 unspecified role unspecified role prey prey hnrl1_human 744971 unspecified role unspecified role bait bait physical association physical association false false false homomint mint brd7-hnrnpul1-1 744968 brd7_human 744970 unspecified role unspecified role neutral component neutral component hnrl1_human 744971 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false F5 homomint mint hnrnpul1-brd7-2 744969 brd7_human 744970 unspecified role unspecified role prey prey hnrl1_human 744971 unspecified role unspecified role bait bait physical association physical association false false false F5 homomint mint