HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html ma-2002b-1 The first hydrophobic domain of the hepatitis C virus E1 protein is important for interaction with the capsid protein. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ma H.C., Ke C.H., Hsieh T.Y., Lo S.Y. Virus - Publications including interactions involving viral proteins losylo!mail.tcu.edu.tw J. Gen. Virol. (0022-1317) 2002 imex curation Only protein-protein interactions imex curation ma-2002b-2 The first hydrophobic domain of the hepatitis C virus E1 protein is important for interaction with the capsid protein. human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ma H.C., Ke C.H., Hsieh T.Y., Lo S.Y. Virus - Publications including interactions involving viral proteins losylo!mail.tcu.edu.tw J. Gen. Virol. (0022-1317) 2002 imex curation Only protein-protein interactions imex curation p29846-pro_0000037669 Envelope glycoprotein E1 protein protein hcvtw Hepatitis C virus genotype 1b (isolate Taiwan) (HCV) YEVHNVSGIYHVTNDCSNSSIVYEAADMIMHTPGCVPCVRENNSSRCWVALTPTLAARNNSVPTATIRRHVDLLVGAAAFCSAMYVGDLCGSVFLVSQLFTFSPRRYETVQDCNCSIYPGHVTGHRMAWDMMMNWSPTTALVVSQLLRIPQAVVDMVGGAHWGVLAGLAYYSMVGNWAKVLIVMLLFAGVDG 192 383 p29846-pro_0000037666 Core protein precursor protein protein hcvtw Hepatitis C virus genotype 1b (isolate Taiwan) (HCV) STNGKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTWERSQPRGRRQPIPKARQPEGRAWAQPGYPWPLYGNEGLGWAGWLVSPRGSRPNWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGVARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTIPASA 2 191 p29846_pro-p29846_pro-1 1457151 n/a E1 1457153 unspecified role unspecified role prey prey P29846-PRO_0000037669:p.Gly192Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P29846-PRO_0000037669:p.Ser136Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false n/a Core 1457154 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1 and 4 p29846_pro-p29846_pro-3 1457152 n/a Core 1457154 unspecified role unspecified role bait bait n/a E1 1457153 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 6