HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html tong-2002b-2 Physical interaction between hepatitis C virus NS4B protein and CREB-RP/ATF6beta. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tong W.Y., Nagano-Fujii M., Hidajat R., Deng L., Takigawa Y., Hotta H. Virus - Publications including interactions involving viral proteins hotta@kobe-u.ac.jp Hela cells cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2002 imex curation Only protein-protein interactions imex curation tong-2002b-1 Physical interaction between hepatitis C virus NS4B protein and CREB-RP/ATF6beta. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Tong W.Y., Nagano-Fujii M., Hidajat R., Deng L., Takigawa Y., Hotta H. Virus - Publications including interactions involving viral proteins hotta@kobe-u.ac.jp Hela cells cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2002 imex curation Only protein-protein interactions imex curation tong-2002b-3 Physical interaction between hepatitis C virus NS4B protein and CREB-RP/ATF6beta. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tong W.Y., Nagano-Fujii M., Hidajat R., Deng L., Takigawa Y., Hotta H. Virus - Publications including interactions involving viral proteins hotta@kobe-u.ac.jp Hela cells cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2002 imex curation Only protein-protein interactions imex curation tong-2002b-4 Physical interaction between hepatitis C virus NS4B protein and CREB-RP/ATF6beta. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Tong W.Y., Nagano-Fujii M., Hidajat R., Deng L., Takigawa Y., Hotta H. Virus - Publications including interactions involving viral proteins hotta@kobe-u.ac.jp Hela cells cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2002 imex curation Only protein-protein interactions imex curation atf6b_human Cyclic AMP-dependent transcription factor ATF-6 beta ATF6B CREBL1 G13 Activating transcription factor 6 beta Protein G13 cAMP response element-binding protein-related protein cAMP-responsive element-binding protein-like 1 protein protein human Homo sapiens Human MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPSSEALGVGEVLHVKTESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSDVQTKIEPVSPCSSVNSEASLLSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSLDGSSGKALPTRKPPLQPKPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPPSAPISPRMNKGEPQPRRHLLGFSEQEPVQGVEPLQGSSQGPKEPQPSPTDQPSFSNLTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTSTVPPSLRKQPSPTPGNATGGPLPVSAASQAHQASHQPLYLNHP p27958-pro_0000037575 Non-structural protein 4B protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SQHLPYIEQGMMLAEQFKQKALGLLQTASRHAEVITPAVQTNWQKLEVFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTGQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAALDSVGLGKVLVDILAGYGAGVAGALVAFKIMSGEVPSTEDLVNLLPAILSPGALAVGVVFASILRRRVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTAILSSLTVTQLLRRLHQWISSECTTPC 1712 1972 atf6a_human Cyclic AMP-dependent transcription factor ATF-6 alpha Activating transcription factor 6 alpha ATF6 protein protein human Homo sapiens Human MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTNSSVPAKTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTVVQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNVGSDIAVLRRQQRMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKKENGTLKRQLDEVVSENQRLKVPSPKRRVVCVMIVLAFIILNYGPMSMLEQDSRRMNPSVSPANQRRHLLGFSAKEAQDTSDGIIQKNSYRYDHSVSNDKALMVLTEEPLLYIPPPPCQPLINTTESLRLNHELRGWVHRHEVERTKSRRMTNNQQKTRILQGALEQGSNSQLMAVQYTETTSSISRNSGSELQVYYASPRSYQDFFEAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAININENVINGQDYEVMMQIDCQVMDTRILHIKSSSVPPYLRDQQRNQTNTFFGSPPAATEATHVVSTIPESLQ ns4b-creb-1 1458319 n/a CREB-RP/ATF6b 1458323 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a NS4B 1458324 unspecified role unspecified role bait bait physical association physical association false false false Table 2 atf6b-p27958_pro-1 1458319 n/a CREB-RP/ATF6b 1458323 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NS4B 1458324 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1 p27958_pro-atf6-1 1458319 n/a NS4B 1458324 unspecified role unspecified role bait bait n/a 1458325 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 3 ns4b-creb-4 1458320 n/a CREB-RP/ATF6b 1458323 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a NS4B 1458324 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1 ns4b-creb-2 1458321 n/a CREB-RP/ATF6b 1458323 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a NS4B 1458324 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2 ns4b-creb-3 1458322 n/a CREB-RP/ATF6b 1458323 unspecified role unspecified role neutral component neutral component n/a NS4B 1458324 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 3