UniProt UniProt http://www.uniprot.org zhu-2002a-1 A Kaposi's sarcoma-associated herpesviral protein inhibits virus-mediated induction of type I interferon by blocking IRF-7 phosphorylation and nuclear accumulation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhu F.X., King S.M., Smith E.J., Levy D.E., Yuan Y. Virus - Publications including interactions involving viral proteins KSHV ORF45 has been mapped to UniProt virus reference strain. yuan2@pobox.upenn.edu human lymphocyte cDNA Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 Only protein-protein interactions imex curation zhu-2002a-2 A Kaposi's sarcoma-associated herpesviral protein inhibits virus-mediated induction of type I interferon by blocking IRF-7 phosphorylation and nuclear accumulation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu F.X., King S.M., Smith E.J., Levy D.E., Yuan Y. Virus - Publications including interactions involving viral proteins KSHV ORF45 has been mapped to UniProt virus reference strain. yuan2@pobox.upenn.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 Only protein-protein interactions imex curation zhu-2002a-3 A Kaposi's sarcoma-associated herpesviral protein inhibits virus-mediated induction of type I interferon by blocking IRF-7 phosphorylation and nuclear accumulation. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhu F.X., King S.M., Smith E.J., Levy D.E., Yuan Y. Virus - Publications including interactions involving viral proteins KSHV ORF45 has been mapped to UniProt virus reference strain. yuan2@pobox.upenn.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 Only protein-protein interactions imex curation zhu-2002a-4 A Kaposi's sarcoma-associated herpesviral protein inhibits virus-mediated induction of type I interferon by blocking IRF-7 phosphorylation and nuclear accumulation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhu F.X., King S.M., Smith E.J., Levy D.E., Yuan Y. Virus - Publications including interactions involving viral proteins KSHV ORF45 has been mapped to UniProt virus reference strain. yuan2@pobox.upenn.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 Only protein-protein interactions imex curation zhu-2002a-5 A Kaposi's sarcoma-associated herpesviral protein inhibits virus-mediated induction of type I interferon by blocking IRF-7 phosphorylation and nuclear accumulation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunostaining immunostaining Zhu F.X., King S.M., Smith E.J., Levy D.E., Yuan Y. Virus - Publications including interactions involving viral proteins KSHV ORF45 has been mapped to UniProt virus reference strain. yuan2@pobox.upenn.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2002 Only protein-protein interactions imex curation orf45_hhv8p Protein ORF45 ORF45 protein protein hhv8p Human herpesvirus 8 Kaposi's sarcoma-associated herpesvirus HHV-8 MAMFVRTSSSTHDEERMLPIEGAPRRRPPVKFIFPPPPLSSLPGFGRPRGYAGPTVIDMSAPDDVFAEDTPSPPATPLDLQISPDQSSGESEYDEDEEDEDEEENDDVQEEDEPEGYPADFFQPLSHLRPRPLARRAHTPKPVAVVAGRVRSSTDTAESEASMGWVSQDDGFSPAGLSPSDDEGVAILEPMAAYTGTGAYGLSPASRNSVPGTQSSPYSDPDEGPSWRPLRAAPTAIVDLTSDSDSDDSSNSPDVNNEAAFTDARHFSHQPPSSEEDGEDQGEVLSQRIGLMDVGQKRKRQSTASSGSEDVVRCQRQPNLSRKAVASVIIISSGSDTDEEPSSAVSVIVSPSSTKGHLPTQSPSTSAHSISSGSTTTAGSRCSDPTRILASTPPLCGNGAYNWPWLD irf7_human Interferon regulatory factor 7 IRF7 protein protein human Homo sapiens Human MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRARQRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA q92985-1 Interferon regulatory factor 7 IRF7 protein protein human Homo sapiens Human MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTVLQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRARQRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA orf45-irf7 1456399 n/a 1456404 unspecified role unspecified role bait bait n/a 1456405 unspecified role unspecified role prey prey physical association physical association false false false no figure orf45-irf7-1 1456400 n/a 1456405 unspecified role unspecified role prey prey n/a 1456404 unspecified role unspecified role bait bait physical association physical association false false false no figure irf7-orf45 1456401 n/a 1456404 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain range range false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 1456405 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 1A and supplemental 7 orf45-irf7-2 1456402 n/a 1456406 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1456404 unspecified role unspecified role prey prey physical association physical association false false false 1B orf45-irf7-3 1456403 n/a 1456406 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1456404 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2